BLASTX nr result
ID: Cimicifuga21_contig00022976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022976 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 >ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 719 Score = 60.8 bits (146), Expect = 1e-07 Identities = 37/66 (56%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +2 Query: 2 DDVEKVRKMMGEKGLLKTAGFSLVDIAGSNESESFLENDNGSKHKKSMVYSMLSEMGAQV 181 DDVE VRKMM E+GL KT GFS V I ++SF+E S H+KSM+YS+LS+M Q+ Sbjct: 573 DDVEIVRKMMKERGLTKTTGFSWVHIEEFG-TQSFVE--KASVHRKSMMYSILSDMATQM 629 Query: 182 KL-CRD 196 KL C D Sbjct: 630 KLSCGD 635