BLASTX nr result
ID: Cimicifuga21_contig00022524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00022524 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGG19195.1| thioredoxin H-type 4, partial [Tamarix hispida] 65 6e-09 ref|NP_001236052.1| uncharacterized protein LOC100527691 [Glycin... 65 8e-09 ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS... 64 2e-08 gb|ACU15762.1| unknown [Glycine max] 64 2e-08 pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 Fro... 63 2e-08 >gb|AGG19195.1| thioredoxin H-type 4, partial [Tamarix hispida] Length = 137 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -3 Query: 144 SKESRVRAFHTTNEWKKHLDNIKGSYPLMVIDFTASWCTPCKFIEPA 4 S S V +FH+ N W+ HL++ K S L+V+DFTASWC PCKF+EPA Sbjct: 24 SDSSLVMSFHSANRWQLHLNSAKESNQLLVVDFTASWCGPCKFMEPA 70 >ref|NP_001236052.1| uncharacterized protein LOC100527691 [Glycine max] gi|255632962|gb|ACU16835.1| unknown [Glycine max] Length = 126 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -3 Query: 180 SSFQTYSHPYGSSKESRVRAFHTTNEWKKHLDNIKGSYPLMVIDFTASWCTPCKFIEP 7 ++F T+ SS S V FH+T +WK H D K + LMVIDFTA+WC PCK+++P Sbjct: 3 ANFSTFEFVEKSSHSSLVLTFHSTAKWKAHFDASKETNKLMVIDFTATWCGPCKYMDP 60 >ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS88427.1| thioredoxin [Glycine max] Length = 135 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 144 SKESRVRAFHTTNEWKKHLDNIKGSYPLMVIDFTASWCTPCKFIEPA 4 S SRV++FH++ W+ H + +K + L+VIDF+ASWC PCKFIEPA Sbjct: 22 SSASRVQSFHSSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPA 68 >gb|ACU15762.1| unknown [Glycine max] Length = 157 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 144 SKESRVRAFHTTNEWKKHLDNIKGSYPLMVIDFTASWCTPCKFIEPA 4 S SRV++FH++ W+ H + +K + L+VIDF+ASWC PCKFIEPA Sbjct: 44 SSASRVQSFHSSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPA 90 >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -3 Query: 144 SKESRVRAFHTTNEWKKHLDNIKGSYPLMVIDFTASWCTPCKFIEPAF 1 ++E +V A HT + WK+H + KGS L+V+DFTASWC PCK I P F Sbjct: 1 AEEGQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIF 48