BLASTX nr result
ID: Cimicifuga21_contig00021985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021985 (1872 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276142.2| PREDICTED: pentatricopeptide repeat-containi... 87 9e-18 emb|CAN82291.1| hypothetical protein VITISV_021279 [Vitis vinifera] 87 1e-17 ref|XP_002525134.1| pentatricopeptide repeat-containing protein,... 80 1e-14 ref|XP_002876469.1| pentatricopeptide repeat-containing protein ... 87 2e-14 ref|XP_002326026.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-14 >ref|XP_002276142.2| PREDICTED: pentatricopeptide repeat-containing protein At3g58590-like [Vitis vinifera] Length = 921 Score = 87.4 bits (215), Expect(2) = 9e-18 Identities = 47/88 (53%), Positives = 59/88 (67%) Frame = +2 Query: 251 QILPHNCTFVSLLNVNTKL*YLAFESSIHRHIIKMDSICCDMVVCNLLVIM*AQCGSIES 430 QI P N T VSLL+V TKL LA SSIH IIK D CD V N+L+ M +CG IES Sbjct: 578 QIYPDNYTVVSLLSVCTKLCNLALGSSIHGFIIKTDFKFCDTFVFNVLIDMYGKCGCIES 637 Query: 431 FIKVFNHMSRKNLISWTTLISGLRLHGY 514 +K+FN + +N+I+WT LIS L ++GY Sbjct: 638 SLKIFNKIIERNIITWTALISALGVNGY 665 Score = 30.8 bits (68), Expect(2) = 9e-18 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 198 LIAASTRSGDYRRAFEMFKY 257 LIAA R+GDY+ FE+FK+ Sbjct: 554 LIAACARNGDYKEVFELFKH 573 >emb|CAN82291.1| hypothetical protein VITISV_021279 [Vitis vinifera] Length = 954 Score = 87.0 bits (214), Expect(2) = 1e-17 Identities = 47/88 (53%), Positives = 59/88 (67%) Frame = +2 Query: 251 QILPHNCTFVSLLNVNTKL*YLAFESSIHRHIIKMDSICCDMVVCNLLVIM*AQCGSIES 430 QI P N T VSLL+V TKL LA SSIH IIK D CD V N+L+ M +CG IES Sbjct: 578 QIYPDNYTVVSLLSVCTKLCNLALGSSIHGFIIKTDFKFCDTFVFNVLIDMYGKCGCIES 637 Query: 431 FIKVFNHMSRKNLISWTTLISGLRLHGY 514 +K+FN + +N+I+WT LIS L ++GY Sbjct: 638 SLKIFNKIIXRNIITWTALISALGVNGY 665 Score = 30.8 bits (68), Expect(2) = 1e-17 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 198 LIAASTRSGDYRRAFEMFKY 257 LIAA R+GDY+ FE+FK+ Sbjct: 554 LIAACARNGDYKEVFELFKH 573 >ref|XP_002525134.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535593|gb|EEF37261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 792 Score = 80.5 bits (197), Expect(2) = 1e-14 Identities = 43/102 (42%), Positives = 63/102 (61%) Frame = +2 Query: 251 QILPHNCTFVSLLNVNTKL*YLAFESSIHRHIIKMDSICCDMVVCNLLVIM*AQCGSIES 430 QI P N T+VSLL+ ++++ LA SSIH +IK + CD VCN+L+ M +CG + S Sbjct: 540 QIHPDNYTYVSLLSSSSQICDLALGSSIHGFLIKNNFSSCDTFVCNVLLDMYGKCGCLRS 599 Query: 431 FIKVFNHMSRKNLISWTTLISGLRLHGYPSMTWGVTKNMYHR 556 +K+FN M +NLI+WT LIS L ++ K+M H+ Sbjct: 600 SVKIFNSMRDRNLITWTALISALGINSCAHEALERFKDMEHQ 641 Score = 27.3 bits (59), Expect(2) = 1e-14 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 201 IAASTRSGDYRRAFEMFKYCL 263 IAA R+G+Y+ FE+FK L Sbjct: 517 IAACARNGNYKEVFELFKQML 537 >ref|XP_002876469.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322307|gb|EFH52728.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 741 Score = 86.7 bits (213), Expect(2) = 2e-14 Identities = 46/87 (52%), Positives = 56/87 (64%) Frame = +2 Query: 254 ILPHNCTFVSLLNVNTKL*YLAFESSIHRHIIKMDSICCDMVVCNLLVIM*AQCGSIESF 433 I P N TFVS+L++ +KL L SSIH I K D C D VCN+L+ M +CGSI S Sbjct: 541 IRPDNYTFVSILSLCSKLCDLTLGSSIHGLITKTDFSCVDTFVCNVLIDMYGKCGSIRSV 600 Query: 434 IKVFNHMSRKNLISWTTLISGLRLHGY 514 IKVF KNLI+WT LIS L ++GY Sbjct: 601 IKVFEETREKNLITWTALISSLGIYGY 627 Score = 20.4 bits (41), Expect(2) = 2e-14 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 201 IAASTRSGDYRRAFEMFKYCL 263 IAA +RS ++ ++FK+ L Sbjct: 517 IAACSRSDNHGEVIDLFKHML 537 >ref|XP_002326026.1| predicted protein [Populus trichocarpa] gi|222862901|gb|EEF00408.1| predicted protein [Populus trichocarpa] Length = 737 Score = 78.6 bits (192), Expect(2) = 4e-14 Identities = 41/87 (47%), Positives = 61/87 (70%) Frame = +2 Query: 251 QILPHNCTFVSLLNVNTKL*YLAFESSIHRHIIKMDSICCDMVVCNLLVIM*AQCGSIES 430 Q+LP N T+ SLL V++K+ LA SSIH +IK + D+VV N+L+ M +CG++ES Sbjct: 539 QMLPDNYTYTSLLCVSSKVCNLALGSSIHGLLIKTNFSYFDIVVRNVLIDMYGKCGNLES 598 Query: 431 FIKVFNHMSRKNLISWTTLISGLRLHG 511 K+F+ M+ +NLI+WT LIS L ++G Sbjct: 599 SAKIFDSMTERNLITWTALISALGING 625 Score = 27.3 bits (59), Expect(2) = 4e-14 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 198 LIAASTRSGDYRRAFEMFKYCLTIALL 278 +IAA R+G+Y FE+FK+ +L Sbjct: 515 VIAACARNGNYNEVFELFKHMRVAQML 541