BLASTX nr result
ID: Cimicifuga21_contig00021960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021960 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003559017.1| PREDICTED: branched-chain-amino-acid aminotr... 56 3e-06 dbj|BAJ90211.1| predicted protein [Hordeum vulgare subsp. vulgar... 56 3e-06 tpg|DAA46204.1| TPA: branched-chain-amino-acid aminotransferase ... 55 8e-06 ref|XP_003574299.1| PREDICTED: branched-chain-amino-acid aminotr... 55 8e-06 gb|ACF84284.1| unknown [Zea mays] gi|195624640|gb|ACG34150.1| br... 55 8e-06 >ref|XP_003559017.1| PREDICTED: branched-chain-amino-acid aminotransferase 5, chloroplastic-like [Brachypodium distachyon] Length = 408 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 6 GVGVVAQQLYSSLTSLQMGLAEDTMGWTVGLN 101 GVG ++QQLY+SLTSLQMGLAED MGWTV LN Sbjct: 377 GVGALSQQLYTSLTSLQMGLAEDRMGWTVQLN 408 >dbj|BAJ90211.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326508562|dbj|BAJ95803.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326516976|dbj|BAJ96480.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 410 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 6 GVGVVAQQLYSSLTSLQMGLAEDTMGWTVGLN 101 GVG V+QQLY+SLTSLQMG AED+MGWTV LN Sbjct: 379 GVGAVSQQLYTSLTSLQMGQAEDSMGWTVQLN 410 >tpg|DAA46204.1| TPA: branched-chain-amino-acid aminotransferase [Zea mays] Length = 402 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 GVGVVAQQLYSSLTSLQMGLAEDTMGWTVGLN 101 GVGVV+QQLY+SLTSLQMG ED MGWTV LN Sbjct: 371 GVGVVSQQLYTSLTSLQMGQTEDWMGWTVQLN 402 >ref|XP_003574299.1| PREDICTED: branched-chain-amino-acid aminotransferase 5, chloroplastic-like [Brachypodium distachyon] Length = 409 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 6 GVGVVAQQLYSSLTSLQMGLAEDTMGWTVGLN 101 GVG V+QQLY++LTSLQMG AED+MGWTV LN Sbjct: 378 GVGAVSQQLYTALTSLQMGQAEDSMGWTVQLN 409 >gb|ACF84284.1| unknown [Zea mays] gi|195624640|gb|ACG34150.1| branched-chain-amino-acid aminotransferase [Zea mays] gi|414867648|tpg|DAA46205.1| TPA: branched-chain-amino-acid aminotransferase [Zea mays] Length = 401 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 GVGVVAQQLYSSLTSLQMGLAEDTMGWTVGLN 101 GVGVV+QQLY+SLTSLQMG ED MGWTV LN Sbjct: 370 GVGVVSQQLYTSLTSLQMGQTEDWMGWTVQLN 401