BLASTX nr result
ID: Cimicifuga21_contig00021729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021729 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22654.1| unknown [Picea sitchensis] 56 3e-06 ref|XP_002519702.1| conserved hypothetical protein [Ricinus comm... 54 5e-06 >gb|ABK22654.1| unknown [Picea sitchensis] Length = 203 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +1 Query: 34 IHANGEIPREALEEECYNIYAHGHMREKLVGGARVLLRDVLRGGNAVELLDNMIRCMMIR 213 + A+ E+ + + +IYA GHMR+KLVG +R+L+ VL+GG+A L DN I CM + Sbjct: 71 LQADDELLSQNMAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAANLYDNPIGCMPVL 130 Query: 214 ER 219 R Sbjct: 131 VR 132 >ref|XP_002519702.1| conserved hypothetical protein [Ricinus communis] gi|223541119|gb|EEF42675.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 85 NIYAHGHMREKLVGGARVLLRDVLRGGNAVELLDNMIRCMMIR 213 +IYAHGH+R+K VG ARVLL DVL+GG +DN I+CM ++ Sbjct: 97 DIYAHGHVRDKPVGSARVLLCDVLKGGRPDVPVDNPIQCMTVQ 139 Score = 21.2 bits (43), Expect(2) = 5e-06 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 47 VKFREKLLKRNVITSM 94 V FRE LL+ N+I ++ Sbjct: 79 VMFRENLLETNIIAAL 94