BLASTX nr result
ID: Cimicifuga21_contig00021652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021652 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG15858.1| harpin-induced protein [Bruguiera gymnorhiza] 61 1e-07 ref|XP_002532540.1| syntaxin, plant, putative [Ricinus communis]... 58 7e-07 gb|ABZ80409.1| hairpin-inducing protein [Casuarina glauca] 55 8e-06 >dbj|BAG15858.1| harpin-induced protein [Bruguiera gymnorhiza] Length = 200 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +1 Query: 133 MAEAKQPILNGAFYGPSIPPQQSYHRHGRSRGFCCGPCCLLSFLCK 270 MAE KQP LNGA+YGP+IPP ++YHR G G CG CCLLSFL K Sbjct: 1 MAE-KQPHLNGAYYGPAIPPPKNYHRPGGRSGSGCG-CCLLSFLFK 44 >ref|XP_002532540.1| syntaxin, plant, putative [Ricinus communis] gi|223527729|gb|EEF29834.1| syntaxin, plant, putative [Ricinus communis] Length = 219 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +1 Query: 133 MAEAKQPILNGAFYGPSIPPQQSYHRHGRSRGFCCGPCCLLSFLCK 270 MAE KQ LNGA+YGP+IPP QSYHR GRS G CG CCLLS L K Sbjct: 1 MAE-KQAQLNGAYYGPAIPPPQSYHRPGRS-GCGCG-CCLLSCLLK 43 >gb|ABZ80409.1| hairpin-inducing protein [Casuarina glauca] Length = 225 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +1 Query: 133 MAEAKQPILNGAFYGPSIPPQ-QSYHRHGRSRGFCCGPCCLLSFLCK 270 MAE KQ LNGA+YGP++PP QSYHR GRS G CG C FL K Sbjct: 1 MAE-KQTNLNGAYYGPAVPPPPQSYHRPGRSGGRGCGCACFFCFLLK 46