BLASTX nr result
ID: Cimicifuga21_contig00021514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021514 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_180568.1| potassium transporter 1 [Arabidopsis thaliana] ... 87 1e-15 ref|XP_002879248.1| hypothetical protein ARALYDRAFT_481917 [Arab... 87 1e-15 ref|XP_003538306.1| PREDICTED: potassium transporter 1-like [Gly... 87 2e-15 emb|CBI15926.3| unnamed protein product [Vitis vinifera] 86 3e-15 ref|XP_002276582.1| PREDICTED: potassium transporter 1-like [Vit... 86 3e-15 >ref|NP_180568.1| potassium transporter 1 [Arabidopsis thaliana] gi|38502834|sp|O22397.2|POT1_ARATH RecName: Full=Potassium transporter 1; Short=AtKT1; Short=AtKUP1; Short=AtPOT1 gi|2654088|gb|AAB87687.1| potassium transporter [Arabidopsis thaliana] gi|2688979|gb|AAB88901.1| high-affinity potassium transporter [Arabidopsis thaliana] gi|3150413|gb|AAC16965.1| high affinity K+ transporter (AtKUP1/AtKT1p) [Arabidopsis thaliana] gi|20197230|gb|AAM14984.1| high affinity K+ transporter (AtKUP1 AtKT1p) [Arabidopsis thaliana] gi|62320122|dbj|BAD94310.1| high affinity K+ transporter [Arabidopsis thaliana] gi|330253247|gb|AEC08341.1| potassium transporter 1 [Arabidopsis thaliana] Length = 712 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = +3 Query: 66 SISGAETMFAELGHFSHFSIKITFTFLVYPYLVLAYMAEAAFLSRHHEDIQRNF 227 SI+G ETMFA+LGHFS SIK+ F+F VYP L+LAYM EAAFLS+HHEDIQ++F Sbjct: 280 SITGVETMFADLGHFSSLSIKVAFSFFVYPCLILAYMGEAAFLSKHHEDIQQSF 333 >ref|XP_002879248.1| hypothetical protein ARALYDRAFT_481917 [Arabidopsis lyrata subsp. lyrata] gi|297325087|gb|EFH55507.1| hypothetical protein ARALYDRAFT_481917 [Arabidopsis lyrata subsp. lyrata] Length = 712 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = +3 Query: 66 SISGAETMFAELGHFSHFSIKITFTFLVYPYLVLAYMAEAAFLSRHHEDIQRNF 227 SI+G ETMFA+LGHFS SIK+ F+F VYP L+LAYM EAAFLS+HHEDIQ++F Sbjct: 280 SITGVETMFADLGHFSSLSIKVAFSFFVYPCLILAYMGEAAFLSKHHEDIQQSF 333 >ref|XP_003538306.1| PREDICTED: potassium transporter 1-like [Glycine max] Length = 720 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = +3 Query: 66 SISGAETMFAELGHFSHFSIKITFTFLVYPYLVLAYMAEAAFLSRHHEDIQRNF 227 SI+G ETMF+ LGHFS +IKI FT LVYP L+LAYM EAAFLSRHHEDIQR+F Sbjct: 280 SITGVETMFSNLGHFSALTIKIAFTCLVYPCLILAYMGEAAFLSRHHEDIQRSF 333 >emb|CBI15926.3| unnamed protein product [Vitis vinifera] Length = 661 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = +3 Query: 66 SISGAETMFAELGHFSHFSIKITFTFLVYPYLVLAYMAEAAFLSRHHEDIQRNF 227 SI+G E MFA+LGHFS SIKI FT LVYP L+LAYM EAA+LSRHHED+QR+F Sbjct: 282 SITGVEMMFADLGHFSALSIKIAFTVLVYPSLILAYMGEAAYLSRHHEDLQRSF 335 >ref|XP_002276582.1| PREDICTED: potassium transporter 1-like [Vitis vinifera] Length = 716 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = +3 Query: 66 SISGAETMFAELGHFSHFSIKITFTFLVYPYLVLAYMAEAAFLSRHHEDIQRNF 227 SI+G E MFA+LGHFS SIKI FT LVYP L+LAYM EAA+LSRHHED+QR+F Sbjct: 282 SITGVEMMFADLGHFSALSIKIAFTVLVYPSLILAYMGEAAYLSRHHEDLQRSF 335