BLASTX nr result
ID: Cimicifuga21_contig00021200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021200 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171251.1| PREDICTED: progestin and adipoq receptor-lik... 91 1e-16 ref|XP_004146666.1| PREDICTED: progestin and adipoq receptor-lik... 91 1e-16 emb|CBI36585.3| unnamed protein product [Vitis vinifera] 89 4e-16 ref|XP_002274323.1| PREDICTED: progestin and adipoq receptor-lik... 89 4e-16 emb|CAN61543.1| hypothetical protein VITISV_008489 [Vitis vinifera] 89 4e-16 >ref|XP_004171251.1| PREDICTED: progestin and adipoq receptor-like protein 1-like, partial [Cucumis sativus] Length = 138 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -1 Query: 236 LVKYEALPEYMKDNEFILDYYRCEWPLKEAFLSVFSLHNETLNVWTH 96 LVK++ LPEY+KDNEFILDYYRCEWP+KEA SVFS HNETLN+WTH Sbjct: 36 LVKFKDLPEYLKDNEFILDYYRCEWPVKEALYSVFSWHNETLNIWTH 82 >ref|XP_004146666.1| PREDICTED: progestin and adipoq receptor-like protein 1-like [Cucumis sativus] Length = 361 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -1 Query: 236 LVKYEALPEYMKDNEFILDYYRCEWPLKEAFLSVFSLHNETLNVWTH 96 LVK++ LPEY+KDNEFILDYYRCEWP+KEA SVFS HNETLN+WTH Sbjct: 36 LVKFKDLPEYLKDNEFILDYYRCEWPVKEALYSVFSWHNETLNIWTH 82 >emb|CBI36585.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 236 LVKYEALPEYMKDNEFILDYYRCEWPLKEAFLSVFSLHNETLNVWTH 96 LVK++ALPEY+KDNE+ILD+YR EWPLK+A LSVFS HNETLNVWTH Sbjct: 32 LVKFDALPEYLKDNEYILDHYRSEWPLKDAILSVFSWHNETLNVWTH 78 >ref|XP_002274323.1| PREDICTED: progestin and adipoq receptor-like protein 1-like [Vitis vinifera] Length = 372 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 236 LVKYEALPEYMKDNEFILDYYRCEWPLKEAFLSVFSLHNETLNVWTH 96 LVK++ALPEY+KDNE+ILD+YR EWPLK+A LSVFS HNETLNVWTH Sbjct: 32 LVKFDALPEYLKDNEYILDHYRSEWPLKDAILSVFSWHNETLNVWTH 78 >emb|CAN61543.1| hypothetical protein VITISV_008489 [Vitis vinifera] Length = 553 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 236 LVKYEALPEYMKDNEFILDYYRCEWPLKEAFLSVFSLHNETLNVWTH 96 LVK++ALPEY+KDNE+ILD+YR EWPLK+A LSVFS HNETLNVWTH Sbjct: 213 LVKFDALPEYLKDNEYILDHYRSEWPLKDAILSVFSWHNETLNVWTH 259