BLASTX nr result
ID: Cimicifuga21_contig00021118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021118 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854... 61 1e-07 >ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854863 [Vitis vinifera] gi|302142887|emb|CBI20182.3| unnamed protein product [Vitis vinifera] Length = 58 Score = 60.8 bits (146), Expect = 1e-07 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 5/57 (8%) Frame = +1 Query: 130 MPGEE---AGPKLVRLLAFVGAGVICTTAINLWRDLERKAAEQRITSELLEK--NNL 285 M GEE AGPK++R+L FVGAG ICT AIN WRDL+RK+A+Q +L EK NNL Sbjct: 1 MIGEEGGPAGPKVLRMLYFVGAGFICTAAINKWRDLQRKSAQQH-ADQLPEKPANNL 56