BLASTX nr result
ID: Cimicifuga21_contig00021046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00021046 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-18 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 86 4e-15 ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containi... 85 7e-15 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 78 9e-13 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 94.7 bits (234), Expect = 7e-18 Identities = 51/87 (58%), Positives = 65/87 (74%) Frame = -3 Query: 261 SLHFQVTQYSHILPLFSSSLQNQVSNFDFLSTYQKLHFSSKPNSIVELVETNNWSEDLEK 82 SL +QVTQ S P FS+ Q+ S F ++ Y KL FSSKPNSIVELV N+WS++LE Sbjct: 27 SLCYQVTQSSRFSPSFSN--QSYTSAFPYI-LYGKLFFSSKPNSIVELVLENDWSDELES 83 Query: 81 ELEKSNPTLTHECVLYVLKRLDRNPQK 1 ELEKS+ LTHE V+YVLK+LD++PQ+ Sbjct: 84 ELEKSSSVLTHETVIYVLKKLDKDPQR 110 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/82 (48%), Positives = 60/82 (73%) Frame = -3 Query: 246 VTQYSHILPLFSSSLQNQVSNFDFLSTYQKLHFSSKPNSIVELVETNNWSEDLEKELEKS 67 +TQ +H P F S + S D+++ ++KL+ SSKP+S+VEL+ N+WS +LE +LE S Sbjct: 29 LTQVTHFFPCFLSREHSYTS--DYVNIHKKLYSSSKPSSLVELLSVNDWSPELETQLENS 86 Query: 66 NPTLTHECVLYVLKRLDRNPQK 1 +P LTHE V+YVLK+LD++P K Sbjct: 87 SPLLTHETVIYVLKKLDKDPHK 108 >ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 84.7 bits (208), Expect = 7e-15 Identities = 44/88 (50%), Positives = 60/88 (68%) Frame = -3 Query: 264 RSLHFQVTQYSHILPLFSSSLQNQVSNFDFLSTYQKLHFSSKPNSIVELVETNNWSEDLE 85 RSL Q +H S L + +F + +Q L+FSSKPNSIVELV T++WS+ LE Sbjct: 26 RSLLLTRNQVTHFSLCTPSPLLDNSHHFLLPNIHQNLYFSSKPNSIVELVLTSDWSKGLE 85 Query: 84 KELEKSNPTLTHECVLYVLKRLDRNPQK 1 +ELEK P++THE V+YVLKR++ NP+K Sbjct: 86 QELEKCYPSMTHETVVYVLKRMEANPEK 113 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 83.2 bits (204), Expect = 2e-14 Identities = 48/88 (54%), Positives = 60/88 (68%) Frame = -3 Query: 264 RSLHFQVTQYSHILPLFSSSLQNQVSNFDFLSTYQKLHFSSKPNSIVELVETNNWSEDLE 85 RS + QVT++S P S Q+ VS+F + L FSS P S+++LV TN+WSE LE Sbjct: 21 RSRYPQVTRFS---PSSYVSHQSLVSHFTI--NHPVLFFSSNPQSLLQLVSTNDWSEMLE 75 Query: 84 KELEKSNPTLTHECVLYVLKRLDRNPQK 1 ELE NPTLTHE V+YVLKRLD+ PQK Sbjct: 76 TELETLNPTLTHETVVYVLKRLDKQPQK 103 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 77.8 bits (190), Expect = 9e-13 Identities = 45/87 (51%), Positives = 60/87 (68%), Gaps = 4/87 (4%) Frame = -3 Query: 249 QVTQYS--HILPLFSSSLQNQVSNFDFLSTYQKLHFSSKP--NSIVELVETNNWSEDLEK 82 QVT +S + LPLF S + F T+ KL+FS+KP NSIVEL+ TN+WS+ LE Sbjct: 28 QVTHFSLHNPLPLFDRS-----HHLRFPITHHKLYFSTKPKPNSIVELLLTNDWSQALEL 82 Query: 81 ELEKSNPTLTHECVLYVLKRLDRNPQK 1 +LE P++ HE VLYV+KRLD+NP+K Sbjct: 83 KLENRFPSMPHETVLYVIKRLDKNPEK 109