BLASTX nr result
ID: Cimicifuga21_contig00019850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019850 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002988245.1| hypothetical protein SELMODRAFT_127798 [Sela... 55 6e-06 ref|XP_002991379.1| hypothetical protein SELMODRAFT_429723 [Sela... 55 6e-06 >ref|XP_002988245.1| hypothetical protein SELMODRAFT_127798 [Selaginella moellendorffii] gi|300143977|gb|EFJ10664.1| hypothetical protein SELMODRAFT_127798 [Selaginella moellendorffii] Length = 124 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +2 Query: 128 DEIEAALRSVGCPYGLQAHQIDNFDYNGIYPVVHWVVRRI 247 + IE+AL+ +GCPY LQAHQI DY + PVV W+V+R+ Sbjct: 63 EAIESALQRMGCPYPLQAHQIQGLDYPAVLPVVQWLVKRV 102 >ref|XP_002991379.1| hypothetical protein SELMODRAFT_429723 [Selaginella moellendorffii] gi|300140772|gb|EFJ07491.1| hypothetical protein SELMODRAFT_429723 [Selaginella moellendorffii] Length = 452 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +2 Query: 128 DEIEAALRSVGCPYGLQAHQIDNFDYNGIYPVVHWVVRRI 247 + IE+AL+ +GCPY LQAHQI DY + PVV W+V+R+ Sbjct: 63 EAIESALQRMGCPYPLQAHQIQGLDYPAVLPVVQWLVKRV 102