BLASTX nr result
ID: Cimicifuga21_contig00019753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019753 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609980.1| Polygalacturonase-like protein [Medicago tru... 60 2e-07 ref|XP_002516244.1| polygalacturonase, putative [Ricinus communi... 55 8e-06 >ref|XP_003609980.1| Polygalacturonase-like protein [Medicago truncatula] gi|355511035|gb|AES92177.1| Polygalacturonase-like protein [Medicago truncatula] Length = 563 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = +2 Query: 122 MVESLTYGRFCHQR------IPGLISSHWTFFTVLWIVGGASLFIWQRNNLVDGFWI 274 MVE+ T GRF HQR +P I+SH T F VLWI S+FIWQRN +V GF + Sbjct: 1 MVETSTLGRFHHQRLDFKRCVPAFITSHKTLFMVLWIAAFLSVFIWQRNMVVGGFMV 57 >ref|XP_002516244.1| polygalacturonase, putative [Ricinus communis] gi|223544730|gb|EEF46246.1| polygalacturonase, putative [Ricinus communis] Length = 494 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 6/56 (10%) Frame = +2 Query: 119 IMVESLTYGRFCHQR------IPGLISSHWTFFTVLWIVGGASLFIWQRNNLVDGF 268 +M+E+ + GR +QR +P SSH T FTVLWI AS+F+WQRN + DGF Sbjct: 1 MMLETASLGRLHYQRLELKRWVPTFFSSHKTLFTVLWIAAFASVFVWQRNVVGDGF 56