BLASTX nr result
ID: Cimicifuga21_contig00019542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019542 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus ... 58 7e-07 ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542641|gb|EEF44178.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 406 Score = 58.2 bits (139), Expect = 7e-07 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 9/123 (7%) Frame = -3 Query: 364 TKMERLPSEITTNILSRLRVKPSARCRCVSKLWCEILSDP---KLQLNQL---SSISPDV 203 T + LP ++ ILSR+ VKP R +CVSK W I+SDP KLQL + S+IS + Sbjct: 48 TSISTLPEDLIVEILSRVPVKPLLRFKCVSKSWNSIISDPRFAKLQLKRAKENSNISCNR 107 Query: 202 FLYEFFSTRIYFLEDDEEYNEAFNSEEPIKPLKMFDKPFIVE---TFYETPTILGYCKGL 32 L +S R EAF ++ + P IV+ TFY ILG C GL Sbjct: 108 LLLSTWSPRSLDF-------EAFCDDDLSNTITNVSFPAIVKGPPTFY--VRILGSCDGL 158 Query: 31 ICI 23 +C+ Sbjct: 159 VCL 161 >ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Length = 374 Score = 56.6 bits (135), Expect = 2e-06 Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 3/115 (2%) Frame = -3 Query: 361 KMERLPSEITTNILSRLRVKPSARCRCVSKLWCEILSDPKLQLNQLSSISPDVFLYE--- 191 K+ +LPSEI + ILSRL VK R +CVSK W ++S P+ N L D Sbjct: 4 KIPKLPSEIISEILSRLPVKCLVRFKCVSKTWRSLISHPEFVKNHLKRTKEDTNANHYKI 63 Query: 190 FFSTRIYFLEDDEEYNEAFNSEEPIKPLKMFDKPFIVETFYETPTILGYCKGLIC 26 F ST + D E Y F++++ + ++ K + Y ILG C GL+C Sbjct: 64 FLSTDPHLSIDPEAY---FDADDNLLTTQL--KFPVSYPEYSYIEILGSCNGLVC 113