BLASTX nr result
ID: Cimicifuga21_contig00017678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017678 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus ... 55 6e-06 ref|XP_003634850.1| PREDICTED: 50S ribosomal protein L4-like [Vi... 55 8e-06 >ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus communis] gi|223542267|gb|EEF43809.1| 50S ribosomal protein L4, putative [Ricinus communis] Length = 294 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +3 Query: 306 EGGLCYFASKMFSTSILTPQSSEAGFPQELLSTKSVLTPDRKQGSYEDLI 455 + G A + STSILTP SS+ FP +LLSTK++LTP+R+ G +EDL+ Sbjct: 35 KNGAASLACRKLSTSILTPGSSDDAFPSDLLSTKTLLTPEREIGLHEDLV 84 >ref|XP_003634850.1| PREDICTED: 50S ribosomal protein L4-like [Vitis vinifera] gi|297741766|emb|CBI32995.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +3 Query: 312 GLCYFASKMFSTS-ILTPQSSEAGFPQELLSTKSVLTPDRKQGSYEDLI 455 G + +S+ ST+ ILTP+SS FP ELLSTK+VLTP+R G Y+DL+ Sbjct: 57 GSSFLSSRSLSTTTILTPESSGVAFPPELLSTKTVLTPERTPGHYQDLV 105