BLASTX nr result
ID: Cimicifuga21_contig00017558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017558 (180 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273627.2| PREDICTED: diphthamide biosynthesis protein ... 53 4e-06 ref|XP_002530564.1| diphteria toxin resistance protein 2, dph2, ... 54 1e-05 >ref|XP_002273627.2| PREDICTED: diphthamide biosynthesis protein 2-like [Vitis vinifera] gi|296084273|emb|CBI24661.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 53.1 bits (126), Expect(2) = 4e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 3 AILAFNRGSQWTGSYVLEFRDLIDLSPVKL 92 A+LAFNRGSQWTG+YV+EFRDLI SPV++ Sbjct: 369 AMLAFNRGSQWTGAYVMEFRDLISSSPVEV 398 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 122 LQGGYVENFE 151 LQGGYVE+F+ Sbjct: 410 LQGGYVEDFD 419 >ref|XP_002530564.1| diphteria toxin resistance protein 2, dph2, putative [Ricinus communis] gi|223529863|gb|EEF31794.1| diphteria toxin resistance protein 2, dph2, putative [Ricinus communis] Length = 499 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +3 Query: 3 AILAFNRGSQWTGSYVLEFRDLIDLSPVK 89 A++AFNRGSQWTG+YV+EFRDLID SPV+ Sbjct: 367 AMIAFNRGSQWTGAYVMEFRDLIDSSPVE 395