BLASTX nr result
ID: Cimicifuga21_contig00017532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017532 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabi... 117 7e-25 ref|NP_181493.1| dolichyl-phosphate beta-glucosyltransferase [Ar... 117 7e-25 ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase,... 112 3e-23 ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 1e-22 emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] 110 1e-22 >ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] gi|297327505|gb|EFH57925.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 117 bits (294), Expect = 7e-25 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELTLMSVGYRTGMW 182 LKRWCFDVELVYLCKRF+IPM+EISVKWSEIPGSKVS SI +MLWEL LMSVGYRTGMW Sbjct: 272 LKRWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMW 331 Query: 183 EI 188 +I Sbjct: 332 KI 333 >ref|NP_181493.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] Length = 336 Score = 117 bits (294), Expect = 7e-25 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELTLMSVGYRTGMW 182 LKRWCFDVELVYLCKRF+IPM+EISVKWSEIPGSKVS SI +MLWEL LMSVGYRTGMW Sbjct: 272 LKRWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMW 331 Query: 183 EI 188 +I Sbjct: 332 KI 333 >ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi|223529581|gb|EEF31531.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] Length = 335 Score = 112 bits (280), Expect = 3e-23 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELTLMSVGYRTGMW 182 LKRWCFDVE+VYLCK FSIPMIEISV WSEIPGSKV+ SI +MLWEL +MS+GYRTGMW Sbjct: 272 LKRWCFDVEVVYLCKWFSIPMIEISVNWSEIPGSKVNPLSIPNMLWELAIMSIGYRTGMW 331 Query: 183 EI 188 EI Sbjct: 332 EI 333 >ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|296086237|emb|CBI31678.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 110 bits (275), Expect = 1e-22 Identities = 51/64 (79%), Positives = 55/64 (85%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELTLMSVGYRTGMW 182 LKRWCFDVELVYLCK F IPMIEISV WSEIPGSKV+ SI +MLWEL LMS GYRTGMW Sbjct: 273 LKRWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMW 332 Query: 183 EIQS 194 +I + Sbjct: 333 KIST 336 >emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] Length = 251 Score = 110 bits (275), Expect = 1e-22 Identities = 51/64 (79%), Positives = 55/64 (85%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELTLMSVGYRTGMW 182 LKRWCFDVELVYLCK F IPMIEISV WSEIPGSKV+ SI +MLWEL LMS GYRTGMW Sbjct: 188 LKRWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMW 247 Query: 183 EIQS 194 +I + Sbjct: 248 KIST 251