BLASTX nr result
ID: Cimicifuga21_contig00017463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017463 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB61486.1| beta-glucosidase [Consolida orientalis] 92 4e-17 gb|AEB61485.1| beta-glucosidase [Consolida orientalis] 86 3e-15 gb|EEE62263.1| hypothetical protein OsJ_17050 [Oryza sativa Japo... 82 6e-14 gb|EAY94514.1| hypothetical protein OsI_16286 [Oryza sativa Indi... 82 6e-14 emb|CAH66811.1| OSIGBa0135C13.6 [Oryza sativa Indica Group] 82 6e-14 >gb|AEB61486.1| beta-glucosidase [Consolida orientalis] Length = 508 Score = 92.0 bits (227), Expect = 4e-17 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 3 FAWSLLDNFEWAEGYTVRFGINYVDLKTMKRYPKHSSIWFKKFL 134 FAWS LDNFEW +GYTVRFG+NYVD KTMKRYPKH+SIWFKKFL Sbjct: 463 FAWSFLDNFEWVDGYTVRFGLNYVDFKTMKRYPKHASIWFKKFL 506 >gb|AEB61485.1| beta-glucosidase [Consolida orientalis] Length = 512 Score = 85.9 bits (211), Expect = 3e-15 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +3 Query: 3 FAWSLLDNFEWAEGYTVRFGINYVDLKTMKRYPKHSSIWFKKFLHH 140 FAWS LDNFEWA+GYTVRFG+NYV KTM+RYPK S+ WFKKFL H Sbjct: 467 FAWSFLDNFEWADGYTVRFGLNYVGFKTMRRYPKRSANWFKKFLLH 512 >gb|EEE62263.1| hypothetical protein OsJ_17050 [Oryza sativa Japonica Group] Length = 442 Score = 81.6 bits (200), Expect = 6e-14 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 3/68 (4%) Frame = +3 Query: 3 FAWSLLDNFEWAEGYTVRFGINYVDLKT-MKRYPKHSSIWFKKFLH--H*EGNIILFLLE 173 FAWSLLDNFEWAEGYTVRFGIN+VD MKRYPK+S+ WFKKFL + +GN L+ Sbjct: 377 FAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQKSNRDGN---KRLK 433 Query: 174 YFSYNSYS 197 +YN++S Sbjct: 434 RVAYNAFS 441 >gb|EAY94514.1| hypothetical protein OsI_16286 [Oryza sativa Indica Group] Length = 374 Score = 81.6 bits (200), Expect = 6e-14 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 3/68 (4%) Frame = +3 Query: 3 FAWSLLDNFEWAEGYTVRFGINYVDLKT-MKRYPKHSSIWFKKFLH--H*EGNIILFLLE 173 FAWSLLDNFEWAEGYTVRFGIN+VD MKRYPK+S+ WFKKFL + +GN L+ Sbjct: 309 FAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQKSNRDGN---KRLK 365 Query: 174 YFSYNSYS 197 +YN++S Sbjct: 366 RVAYNAFS 373 >emb|CAH66811.1| OSIGBa0135C13.6 [Oryza sativa Indica Group] Length = 529 Score = 81.6 bits (200), Expect = 6e-14 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 3/68 (4%) Frame = +3 Query: 3 FAWSLLDNFEWAEGYTVRFGINYVDLKT-MKRYPKHSSIWFKKFLH--H*EGNIILFLLE 173 FAWSLLDNFEWAEGYTVRFGIN+VD MKRYPK+S+ WFKKFL + +GN L+ Sbjct: 464 FAWSLLDNFEWAEGYTVRFGINFVDYDDGMKRYPKNSARWFKKFLQKSNRDGN---KRLK 520 Query: 174 YFSYNSYS 197 +YN++S Sbjct: 521 RVAYNAFS 528