BLASTX nr result
ID: Cimicifuga21_contig00017404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017404 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149312.1| PREDICTED: (-)-germacrene D synthase-like [C... 110 2e-22 ref|XP_003588311.1| NADH-ubiquinone oxidoreductase chain [Medica... 70 1e-21 ref|YP_004927621.1| hypothetical protein AnruMp19 (mitochondrion... 64 1e-14 ref|XP_003588406.1| hypothetical protein MTR_1g006900 [Medicago ... 60 1e-12 ref|XP_003588331.1| NADH-ubiquinone oxidoreductase chain [Medica... 74 2e-11 >ref|XP_004149312.1| PREDICTED: (-)-germacrene D synthase-like [Cucumis sativus] Length = 828 Score = 110 bits (274), Expect = 2e-22 Identities = 59/92 (64%), Positives = 63/92 (68%), Gaps = 1/92 (1%) Frame = +1 Query: 1 PVLRFRACPSVWSVLHTVGQQSLHLFTNYDGSPGPLSSSLFCSLVGVRTPTKGEGVD*TS 180 PVLRFRACPSVWSVLHTVGQ+SLHLFTNY+GSPGPLSSSLFCSLVG P +G Sbjct: 374 PVLRFRACPSVWSVLHTVGQRSLHLFTNYEGSPGPLSSSLFCSLVGSGPPQRGRESTEHL 433 Query: 181 QPLAGISPASDPQFLFTP-DDRVG*IVTSYDR 273 P P P D R+G IVTSYDR Sbjct: 434 SHWREFRPHPIPNSCSPPIDSRLGFIVTSYDR 465 >ref|XP_003588311.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477359|gb|AES58562.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 548 Score = 70.5 bits (171), Expect(2) = 1e-21 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 12/57 (21%) Frame = -2 Query: 270 IVRGHNSP------------NTIIRGEQELGIGCGRNSRQWLRCSVDSLPLCGGPDP 136 I+R H++P ++ G ELGIGCGRNSRQWLRCSVDSLPLCGGPDP Sbjct: 356 ILRCHDAPIPMAIPLILLALGSLFVGYLELGIGCGRNSRQWLRCSVDSLPLCGGPDP 412 Score = 57.8 bits (138), Expect(2) = 1e-21 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 83 LVNKCKLCCPTVWSTDHTEGQALKRRT 3 ++NKCKL CPTVWSTDHTEGQALKRRT Sbjct: 415 VINKCKLRCPTVWSTDHTEGQALKRRT 441 >ref|YP_004927621.1| hypothetical protein AnruMp19 (mitochondrion) [Anomodon rugelii] gi|336089478|gb|AEH99668.1| hypothetical protein AnruMp19 [Anomodon rugelii] Length = 124 Score = 63.5 bits (153), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 33/43 (76%) Frame = +1 Query: 1 PVLRFRACPSVWSVLHTVGQQSLHLFTNYDGSPGPLSSSLFCS 129 P R PSVWSVL TVGQQSLHLFT Y GSP PLSSSLFCS Sbjct: 40 PPFHSRIRPSVWSVLDTVGQQSLHLFT-YSGSPRPLSSSLFCS 81 Score = 40.8 bits (94), Expect(2) = 1e-14 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 129 TRRGPDPHKGGGSRLNISAIGGNFARIRSPILVH 230 TR PD + SRLNISAIGGNFARI+ I+VH Sbjct: 84 TRGLPDLLQREESRLNISAIGGNFARIQFSIIVH 117 >ref|XP_003588406.1| hypothetical protein MTR_1g006900 [Medicago truncatula] gi|355477454|gb|AES58657.1| hypothetical protein MTR_1g006900 [Medicago truncatula] Length = 160 Score = 59.7 bits (143), Expect(2) = 1e-12 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 208 MRAKFPPMAEMFSRLPPPLWGSGPLRVSRK 119 MRAKFPPMAEMFSRLPPPLWGSGPL +K Sbjct: 1 MRAKFPPMAEMFSRLPPPLWGSGPLTSEQK 30 Score = 38.1 bits (87), Expect(2) = 1e-12 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 50 VWSTDHTEGQALKRRT 3 VWSTDHTEGQALKRRT Sbjct: 38 VWSTDHTEGQALKRRT 53 >ref|XP_003588331.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477379|gb|AES58582.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 569 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 12/67 (17%) Frame = -2 Query: 270 IVRGHNSP------------NTIIRGEQELGIGCGRNSRQWLRCSVDSLPLCGGPDPYE* 127 I+R H++P ++ G ELGIGCGRNSRQWLRCSVDSLPLCGGPDP Sbjct: 377 ILRCHDAPIPMAIPLILLALGSLFVGYLELGIGCGRNSRQWLRCSVDSLPLCGGPDPLRV 436 Query: 126 AEKGGGK 106 + KG K Sbjct: 437 SRKGRRK 443