BLASTX nr result
ID: Cimicifuga21_contig00017380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017380 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169647.1| PREDICTED: replication protein A 70 kDa DNA-... 69 5e-10 ref|XP_004138198.1| PREDICTED: replication protein A 70 kDa DNA-... 69 5e-10 ref|XP_002514651.1| replication factor A 1, rfa1, putative [Rici... 69 5e-10 ref|XP_002328669.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002468278.1| hypothetical protein SORBIDRAFT_01g042890 [S... 65 6e-09 >ref|XP_004169647.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit-like, partial [Cucumis sativus] Length = 560 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/40 (80%), Positives = 39/40 (97%) Frame = +3 Query: 3 TQNEYNNEKRQRITVRTEAPLDFAAESKFLLEEISKLQAS 122 +QNEYNNEKRQRITVR+ AP+DFAAES+FLLEEI+K++AS Sbjct: 521 SQNEYNNEKRQRITVRSVAPVDFAAESRFLLEEIAKMKAS 560 >ref|XP_004138198.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit-like [Cucumis sativus] Length = 603 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/40 (80%), Positives = 39/40 (97%) Frame = +3 Query: 3 TQNEYNNEKRQRITVRTEAPLDFAAESKFLLEEISKLQAS 122 +QNEYNNEKRQRITVR+ AP+DFAAES+FLLEEI+K++AS Sbjct: 564 SQNEYNNEKRQRITVRSVAPVDFAAESRFLLEEIAKMKAS 603 >ref|XP_002514651.1| replication factor A 1, rfa1, putative [Ricinus communis] gi|223546255|gb|EEF47757.1| replication factor A 1, rfa1, putative [Ricinus communis] Length = 622 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 6 QNEYNNEKRQRITVRTEAPLDFAAESKFLLEEISKLQAS 122 QNEYNNEKRQRITVR APLDFAAES+FLLEEISK++ S Sbjct: 583 QNEYNNEKRQRITVRAVAPLDFAAESRFLLEEISKIKGS 621 >ref|XP_002328669.1| predicted protein [Populus trichocarpa] gi|222838845|gb|EEE77196.1| predicted protein [Populus trichocarpa] Length = 603 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +3 Query: 3 TQNEYNNEKRQRITVRTEAPLDFAAESKFLLEEISKLQAS 122 +QNEYNNEKRQR+TVR AP+DFAAES+FLLEEISK++ S Sbjct: 563 SQNEYNNEKRQRMTVRAVAPVDFAAESRFLLEEISKMKGS 602 >ref|XP_002468278.1| hypothetical protein SORBIDRAFT_01g042890 [Sorghum bicolor] gi|241922132|gb|EER95276.1| hypothetical protein SORBIDRAFT_01g042890 [Sorghum bicolor] Length = 623 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 TQNEYNNEKRQRITVRTEAPLDFAAESKFLLEEISKLQA 119 TQ+EY NEKRQRITVR+EAP+D+AAESK+LLEEI+KL A Sbjct: 584 TQHEYMNEKRQRITVRSEAPVDYAAESKYLLEEIAKLTA 622