BLASTX nr result
ID: Cimicifuga21_contig00017369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017369 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] 65 6e-09 dbj|BAD83430.2| ribosomal protein S14 (mitochondrion) [Nicotiana... 63 3e-08 >ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] Length = 119 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 337 FSWISISRFFDGHKEIVLVATTKPIEQGLALQLVHK 230 FSWISISR FDGHKEIVLVATTKPIEQGLA Q V+K Sbjct: 81 FSWISISRSFDGHKEIVLVATTKPIEQGLAPQQVYK 116 >dbj|BAD83430.2| ribosomal protein S14 (mitochondrion) [Nicotiana tabacum] Length = 119 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 337 FSWISISRFFDGHKEIVLVATTKPIEQGLALQLVHK 230 FSWISISR FDGHKEIVLVAT KPIEQGLA Q V+K Sbjct: 81 FSWISISRSFDGHKEIVLVATIKPIEQGLAPQQVYK 116