BLASTX nr result
ID: Cimicifuga21_contig00017159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017159 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160525.1| PREDICTED: UBX domain-containing protein 2-l... 109 2e-22 ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-l... 109 2e-22 ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-l... 109 2e-22 ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-l... 109 2e-22 ref|XP_002521873.1| UBX domain-containing protein, putative [Ric... 107 1e-21 >ref|XP_004160525.1| PREDICTED: UBX domain-containing protein 2-like [Cucumis sativus] Length = 288 Score = 109 bits (273), Expect = 2e-22 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = +3 Query: 9 DKSLLCRVGVRLPDGQRSQLNFLRTDPIQLLWSFYRSQIEEAEVRPFSLKMAIPGASKCV 188 D+ LLCR+GVRLP+G+R Q NFLRTDPIQLLWSF SQ+E+ E +PF L AIPGA+K + Sbjct: 206 DRKLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTL 265 Query: 189 DYDSKLTFVESGLA 230 DYD+++TF ESGLA Sbjct: 266 DYDTQMTFEESGLA 279 >ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus] Length = 450 Score = 109 bits (273), Expect = 2e-22 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = +3 Query: 9 DKSLLCRVGVRLPDGQRSQLNFLRTDPIQLLWSFYRSQIEEAEVRPFSLKMAIPGASKCV 188 D+ LLCR+GVRLP+G+R Q NFLRTDPIQLLWSF SQ+E+ E +PF L AIPGA+K + Sbjct: 368 DRKLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTL 427 Query: 189 DYDSKLTFVESGLA 230 DYD+++TF ESGLA Sbjct: 428 DYDTQMTFEESGLA 441 >ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-like isoform 1 [Vitis vinifera] Length = 447 Score = 109 bits (273), Expect = 2e-22 Identities = 54/74 (72%), Positives = 61/74 (82%) Frame = +3 Query: 9 DKSLLCRVGVRLPDGQRSQLNFLRTDPIQLLWSFYRSQIEEAEVRPFSLKMAIPGASKCV 188 D++LLCRVGVRLPDG+R Q NFLRTDPIQLLWSF SQ+EE RPF L AIPGAS+ + Sbjct: 365 DRNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNL 424 Query: 189 DYDSKLTFVESGLA 230 DYD +LTF ESGLA Sbjct: 425 DYDRELTFEESGLA 438 >ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-like isoform 2 [Vitis vinifera] gi|297738308|emb|CBI27509.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 109 bits (273), Expect = 2e-22 Identities = 54/74 (72%), Positives = 61/74 (82%) Frame = +3 Query: 9 DKSLLCRVGVRLPDGQRSQLNFLRTDPIQLLWSFYRSQIEEAEVRPFSLKMAIPGASKCV 188 D++LLCRVGVRLPDG+R Q NFLRTDPIQLLWSF SQ+EE RPF L AIPGAS+ + Sbjct: 374 DRNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNL 433 Query: 189 DYDSKLTFVESGLA 230 DYD +LTF ESGLA Sbjct: 434 DYDRELTFEESGLA 447 >ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] Length = 452 Score = 107 bits (266), Expect = 1e-21 Identities = 53/74 (71%), Positives = 62/74 (83%) Frame = +3 Query: 9 DKSLLCRVGVRLPDGQRSQLNFLRTDPIQLLWSFYRSQIEEAEVRPFSLKMAIPGASKCV 188 ++S+LCRVG+RLPDG+R Q NFL+TDPIQLLWSF SQ+EEA RPF L AIPGA K + Sbjct: 371 ERSILCRVGLRLPDGRRIQRNFLKTDPIQLLWSFCTSQLEEAGTRPFRLTQAIPGA-KSL 429 Query: 189 DYDSKLTFVESGLA 230 DYDSK+TF ESGLA Sbjct: 430 DYDSKVTFGESGLA 443