BLASTX nr result
ID: Cimicifuga21_contig00016318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016318 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323641.1| ferroportin protein family [Populus trichoca... 57 2e-06 >ref|XP_002323641.1| ferroportin protein family [Populus trichocarpa] gi|222868271|gb|EEF05402.1| ferroportin protein family [Populus trichocarpa] Length = 122 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 2 LSFLSVTMAAVLYSFHIYRVRKHLFHFEKLLSLLRCTI 115 LSF +VT+AA+LYS H+YRVRKHLFHFEKL L++ I Sbjct: 70 LSFSAVTVAALLYSIHLYRVRKHLFHFEKLFMLVKWEI 107