BLASTX nr result
ID: Cimicifuga21_contig00016024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016024 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622776.1| F-box/kelch-repeat protein [Medicago truncat... 70 2e-10 ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 67 1e-09 ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 emb|CAN68677.1| hypothetical protein VITISV_041940 [Vitis vinifera] 64 1e-08 ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus ... 64 1e-08 >ref|XP_003622776.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355497791|gb|AES78994.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 401 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 21/102 (20%) Frame = -3 Query: 243 ILSRLPVKSLFRFKCVCKAWSTLISDPYFVNLHLERSSENNNFVLLK------------G 100 +LS LPVKSL + KC CK+W+TL+S P+F+ LHL+RSS+N +F L Sbjct: 30 VLSYLPVKSLMQLKCCCKSWNTLVSKPFFIRLHLQRSSKNPHFTLFNIPDMNKDDTDAVL 89 Query: 99 FGHAYLLDCGICNSRLVSFGTKPFS---------LLSSCNGL 1 L++ +C S+ ++ P+ ++ SCNGL Sbjct: 90 ISFTRLIESSLCLSKSITLTNDPYYRLENKSCCWIVGSCNGL 131 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 243 ILSRLPVKSLFRFKCVCKAWSTLISDPYFVNLHLERSSENNNF 115 ILSRLPV+SL + KCVCK+W+T+ISDP F+ +HL RS+ N NF Sbjct: 102 ILSRLPVRSLMQIKCVCKSWNTIISDPKFIKMHLNRSARNPNF 144 >ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|222847413|gb|EEE84960.1| predicted protein [Populus trichocarpa] Length = 364 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 243 ILSRLPVKSLFRFKCVCKAWSTLISDPYFVNLHLERSSENNN 118 IL+ LPVKSL RFKCVCK W LISDP FV LHL+R+ E NN Sbjct: 12 ILTYLPVKSLVRFKCVCKPWQLLISDPRFVKLHLKRAIEGNN 53 >emb|CAN68677.1| hypothetical protein VITISV_041940 [Vitis vinifera] Length = 485 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = -3 Query: 243 ILSRLPVKSLFRFKCVCKAWSTLISDPYFVNLHLERSSENNNFVLL 106 +L RLPVKS+ RFKCVC++W TL +DP F+N+HL R+ +NN +L Sbjct: 91 VLLRLPVKSIIRFKCVCQSWQTLFNDPDFINMHLRRAITHNNCCML 136 >ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542642|gb|EEF44179.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 257 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 243 ILSRLPVKSLFRFKCVCKAWSTLISDPYFVNLHLERSSENNN 118 ILSR+PVK L RFKC+CK W++LIS+P F L L+R+ ENNN Sbjct: 12 ILSRVPVKPLIRFKCICKTWNSLISNPEFAKLQLKRAKENNN 53