BLASTX nr result
ID: Cimicifuga21_contig00015814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015814 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62773.1| hypothetical protein VITISV_028724 [Vitis vinifera] 55 6e-06 >emb|CAN62773.1| hypothetical protein VITISV_028724 [Vitis vinifera] Length = 113 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/44 (54%), Positives = 37/44 (84%) Frame = +1 Query: 115 KNTKAIQLGGKRKRTWKIKALPKLKLGIKIVSPIRLLAKLRDAY 246 +N K ++LGGK++R W+I+ +PKL L KI+SP++LLAKL++AY Sbjct: 30 RNVKMVRLGGKQRRFWRIRQIPKLHL--KIISPLKLLAKLKNAY 71