BLASTX nr result
ID: Cimicifuga21_contig00015685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015685 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago ... 70 1e-10 gb|AAT38794.1| Putative hAT family dimerisation domain containin... 60 1e-07 gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 59 3e-07 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 59 3e-07 dbj|BAB02591.1| unnamed protein product [Arabidopsis thaliana] 57 1e-06 >ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula] gi|355478915|gb|AES60118.1| hypothetical protein MTR_1g040620 [Medicago truncatula] Length = 665 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/70 (50%), Positives = 45/70 (64%) Frame = +2 Query: 2 EVQSTSKRTHKESDRGGGTSSPGVNDVDIPNLVVDPGLRKQILDYHPNERDTIPRAYLLK 181 EV++T TH++ G + G +VD+ NL +PG RKQ+ YHPN+RD I RAYL K Sbjct: 16 EVETTPTPTHEQP---GPSFKNGFLEVDLENLPANPGERKQLSCYHPNDRDEIRRAYLAK 72 Query: 182 GPC*PMNHNF 211 GPC P HNF Sbjct: 73 GPCQPKEHNF 82 >gb|AAT38794.1| Putative hAT family dimerisation domain containing protein, identical [Solanum demissum] Length = 805 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/63 (47%), Positives = 36/63 (57%) Frame = +2 Query: 8 QSTSKRTHKESDRGGGTSSPGVNDVDIPNLVVDPGLRKQILDYHPNERDTIPRAYLLKGP 187 QS S+ KE+ S + D+ +L DPG R IL+YHPN RD I RAYLL GP Sbjct: 23 QSHSQSNQKENTNHSEVSLDSSQEFDLSSLKFDPGERTSILNYHPNHRDVIRRAYLLNGP 82 Query: 188 C*P 196 C P Sbjct: 83 CQP 85 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +2 Query: 62 SPGVNDVDIPNLVVDPGLRKQILDYHPNERDTIPRAYLLKGPC*PMNHNF 211 SP D+++ L DP RK IL YHPN+RD + R YL++GPC P H F Sbjct: 51 SPPPPDINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKF 100 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +2 Query: 62 SPGVNDVDIPNLVVDPGLRKQILDYHPNERDTIPRAYLLKGPC*PMNHNF 211 SP D+++ L DP RK IL YHPN+RD + R YL++GPC P H F Sbjct: 9 SPPPPDINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKF 58 >dbj|BAB02591.1| unnamed protein product [Arabidopsis thaliana] Length = 571 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/64 (45%), Positives = 38/64 (59%) Frame = +2 Query: 20 KRTHKESDRGGGTSSPGVNDVDIPNLVVDPGLRKQILDYHPNERDTIPRAYLLKGPC*PM 199 KR H+ + + + P D+P+ DPG RK ILDYHPNERD + R YL+KGP Sbjct: 11 KRKHESTSQDIPENIPEAIPEDLPS---DPGDRKHILDYHPNERDEVRRKYLIKGPYQSR 67 Query: 200 NHNF 211 H+F Sbjct: 68 GHDF 71