BLASTX nr result
ID: Cimicifuga21_contig00015637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015637 (880 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-13 ref|XP_002525881.1| pentatricopeptide repeat-containing protein,... 76 9e-12 ref|XP_002514422.1| pentatricopeptide repeat-containing protein,... 76 1e-11 ref|XP_003525573.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-11 gb|ABA95188.1| salt-inducible protein, putative [Oryza sativa Ja... 68 2e-09 >ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Vitis vinifera] Length = 817 Score = 80.9 bits (198), Expect = 4e-13 Identities = 42/68 (61%), Positives = 52/68 (76%) Frame = -3 Query: 878 FDEMMDRGLIPDAVTYTALVSGYCSKGDMDSAVYLVDEMASKGIMADNRTISTLENGFEI 699 +DEM+ RGL PD VTYTAL+S CS+GDMD A+ LV+EM+ KGI D+R +S L G I Sbjct: 751 YDEMIARGLQPDIVTYTALLSSCCSRGDMDRAITLVNEMSFKGIEPDSRAMSVLHRG--I 808 Query: 698 LKARKVKF 675 LKARKV+F Sbjct: 809 LKARKVQF 816 >ref|XP_002525881.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534795|gb|EEF36485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 913 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = -3 Query: 878 FDEMMDRGLIPDAVTYTALVSGYCSKGDMDSAVYLVDEMASKGIMADNRTISTLENGFEI 699 FDEM++RGL PD +TYTAL+SG C +GD+D AV L+D+M+ KGI D RT+S L +G I Sbjct: 759 FDEMIERGLEPDIITYTALLSGCCQRGDVDRAVNLLDQMSLKGISPDTRTMSALLHG--I 816 Query: 698 LKARK 684 LK R+ Sbjct: 817 LKTRQ 821 >ref|XP_002514422.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546418|gb|EEF47918.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 809 Score = 75.9 bits (185), Expect = 1e-11 Identities = 40/68 (58%), Positives = 48/68 (70%) Frame = -3 Query: 878 FDEMMDRGLIPDAVTYTALVSGYCSKGDMDSAVYLVDEMASKGIMADNRTISTLENGFEI 699 F+EM+DRGL PD VTYTAL+SGYC+ G++ AV L DEM +KGI D T+S L I Sbjct: 743 FNEMIDRGLAPDTVTYTALLSGYCNVGNIKKAVVLFDEMLNKGIRPDAHTMSVLHC---I 799 Query: 698 LKARKVKF 675 LK RKV F Sbjct: 800 LKVRKVHF 807 >ref|XP_003525573.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Glycine max] Length = 819 Score = 74.7 bits (182), Expect = 3e-11 Identities = 37/68 (54%), Positives = 52/68 (76%) Frame = -3 Query: 878 FDEMMDRGLIPDAVTYTALVSGYCSKGDMDSAVYLVDEMASKGIMADNRTISTLENGFEI 699 FD+M++ GL PD +TYTALVSG C++G ++ AV L++EM+SKG+ D IS L+ G I Sbjct: 752 FDKMIESGLEPDTITYTALVSGLCNRGHVEKAVTLLNEMSSKGMTPDVHIISALKRG--I 809 Query: 698 LKARKVKF 675 +KARKV+F Sbjct: 810 IKARKVQF 817 >gb|ABA95188.1| salt-inducible protein, putative [Oryza sativa Japonica Group] Length = 938 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/68 (48%), Positives = 45/68 (66%) Frame = -3 Query: 878 FDEMMDRGLIPDAVTYTALVSGYCSKGDMDSAVYLVDEMASKGIMADNRTISTLENGFEI 699 FDEM+ +GL PDA YTAL++GYCS+G++ A L+ EM KGI D T S L Sbjct: 871 FDEMLQKGLTPDAYAYTALINGYCSQGEISKAEDLLQEMIDKGIEPDELTFSVLNQ--SS 928 Query: 698 LKARKVKF 675 L++RK++F Sbjct: 929 LRSRKIQF 936