BLASTX nr result
ID: Cimicifuga21_contig00013121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013121 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529360.1| pentatricopeptide repeat-containing protein,... 46 1e-08 ref|NP_174428.1| pentatricopeptide repeat-containing protein [Ar... 47 6e-07 >ref|XP_002529360.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531180|gb|EEF33027.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 683 Score = 46.2 bits (108), Expect(2) = 1e-08 Identities = 25/77 (32%), Positives = 43/77 (55%) Frame = +1 Query: 121 EILRYQPDSSPFQKIFRYQPDSSPFQKVH*MWEFGDAVDAFRQMEQRNEVRPDETTIVSN 300 ++++ D P + + + S + K F DA++ F +M++ + + PDE T+VS Sbjct: 189 DVMKMLFDEMPDRDVISWNVMISGYVKCR---RFEDAINVFCRMQEESGLMPDEATVVST 245 Query: 301 LSACIALENLELD*KCY 351 LSAC AL+ LEL K + Sbjct: 246 LSACTALKRLELGKKIH 262 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 341 KNVISWTTIVFGYVNCGKLHE 403 KNVI WTT+V GY NCG+L E Sbjct: 302 KNVICWTTMVSGYANCGELEE 322 >ref|NP_174428.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75169458|sp|Q9C866.1|PPR65_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g31430 gi|12322531|gb|AAG51260.1|AC027135_1 PPR-repeat protein [Arabidopsis thaliana] gi|332193234|gb|AEE31355.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 570 Score = 46.6 bits (109), Expect(2) = 6e-07 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +1 Query: 220 FGDAVDAFRQMEQRNEVRPDETTIVSNLSACIALENLELD*KCY 351 F DA+ F++M Q + ++ DE TIVS LSAC AL+NLE+ + Y Sbjct: 128 FEDAIGVFKRMSQESNLKFDEGTIVSTLSACSALKNLEIGERIY 171 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 341 KNVISWTTIVFGYVNCGKLHE 403 KNV WT++VFGYV+ G++ E Sbjct: 211 KNVKCWTSMVFGYVSTGRIDE 231