BLASTX nr result
ID: Cimicifuga21_contig00009568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009568 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| T... 58 1e-06 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 56 5e-06 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 55 8e-06 ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [S... 55 8e-06 >gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| TPA: hypothetical protein ZEAMMB73_336113 [Zea mays] Length = 56 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/55 (50%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +2 Query: 116 MFLGQIPKRPNKEVALKQLKSHLXXXXXXXXXXXXTPYVLHYLC--GEPQELKLD 274 MFLG +P+RP+KE A KQL+SH+ TPY+LH+L G+ QELKLD Sbjct: 1 MFLGSLPRRPSKEAAYKQLRSHIIIMASCAAVIRATPYILHFLARDGDIQELKLD 55 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = +2 Query: 116 MFLGQIPKRPNKEVALKQLKSHLXXXXXXXXXXXXTPYVLHYLCGEPQELKLDF 277 MF G ++P+K ALKQL+SH+ TPYVLHYL E +ELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/53 (49%), Positives = 32/53 (60%) Frame = +2 Query: 116 MFLGQIPKRPNKEVALKQLKSHLXXXXXXXXXXXXTPYVLHYLCGEPQELKLD 274 MF G ++P+K ALKQLKSH TPYVLH+LC E +ELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLE 53 >ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] gi|241920642|gb|EER93786.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] Length = 56 Score = 55.1 bits (131), Expect = 8e-06 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = +2 Query: 116 MFLGQIPKRPNKEVALKQLKSHLXXXXXXXXXXXXTPYVLHYLC--GEPQELKLD 274 MFLG +P+RP+KE A KQL+SHL PY+LH+L G+ QELKL+ Sbjct: 1 MFLGAVPRRPSKEAAYKQLRSHLVIMASCAAVIRAAPYILHFLTRDGDVQELKLE 55