BLASTX nr result
ID: Cimicifuga21_contig00009463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009463 (1076 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002452061.1| hypothetical protein SORBIDRAFT_04g017843 [S... 58 5e-06 >ref|XP_002452061.1| hypothetical protein SORBIDRAFT_04g017843 [Sorghum bicolor] gi|241931892|gb|EES05037.1| hypothetical protein SORBIDRAFT_04g017843 [Sorghum bicolor] Length = 503 Score = 57.8 bits (138), Expect = 5e-06 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Frame = +1 Query: 160 ENGKILEPILKAKVVLDVDEPLAPGFYLPL---IIKGTSWIPFGFEFLPVFCFRCGFIGH 330 ENG+ + L+ KV LD+ +PL G L + + W P +EFLP FCF CG IGH Sbjct: 75 ENGRAVGEFLRIKVRLDIRKPLMRGVTLDIGDGDHENNKWCPLVYEFLPDFCFICGLIGH 134 Query: 331 HHGVCPWSVEEIVPDLYNARNRIFPK 408 CP+ + ++ R P+ Sbjct: 135 VDRACPYYAQNRSSPQFSRALRFIPE 160