BLASTX nr result
ID: Cimicifuga21_contig00009290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009290 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43520.1| unknown [Medicago truncatula] 64 1e-08 ref|XP_003597272.1| Serine carboxypeptidase [Medicago truncatula... 64 1e-08 gb|ACJ85699.1| unknown [Medicago truncatula] 64 1e-08 ref|XP_003597270.1| Serine carboxypeptidase [Medicago truncatula... 63 2e-08 ref|XP_004164209.1| PREDICTED: serine carboxypeptidase-like 49-l... 60 2e-07 >gb|AFK43520.1| unknown [Medicago truncatula] Length = 443 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 3 LLPKDAVKYKDLSLSPSESKIVEKNFRFPGLADSGPSIAELGHHAGYYTIKHSRAAR 173 L PKD++ + I+EK F FPG DSG S+ ELGHHAGYY + HS+AAR Sbjct: 58 LFPKDSINTPENDPHFLHGNIMEKKFTFPGFVDSGASVEELGHHAGYYRLPHSKAAR 114 >ref|XP_003597272.1| Serine carboxypeptidase [Medicago truncatula] gi|355486320|gb|AES67523.1| Serine carboxypeptidase [Medicago truncatula] Length = 511 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 3 LLPKDAVKYKDLSLSPSESKIVEKNFRFPGLADSGPSIAELGHHAGYYTIKHSRAAR 173 L PKD++ + I+EK F FPG DSG S+ ELGHHAGYY + HS+AAR Sbjct: 58 LFPKDSINTPENDPHFLHGNIMEKKFTFPGFVDSGASVEELGHHAGYYRLPHSKAAR 114 >gb|ACJ85699.1| unknown [Medicago truncatula] Length = 269 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 3 LLPKDAVKYKDLSLSPSESKIVEKNFRFPGLADSGPSIAELGHHAGYYTIKHSRAAR 173 L PKD++ + I+EK F FPG DSG S+ ELGHHAGYY + HS+AAR Sbjct: 58 LFPKDSINTPENDPHFLHGNIMEKKFTFPGFVDSGASVEELGHHAGYYRLPHSKAAR 114 >ref|XP_003597270.1| Serine carboxypeptidase [Medicago truncatula] gi|355486318|gb|AES67521.1| Serine carboxypeptidase [Medicago truncatula] Length = 509 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 3 LLPKDAVKYKDLSLSPSESKIVEKNFRFPGLADSGPSIAELGHHAGYYTIKHSRAAR 173 L PK ++ + IVEK F FPG DSG S+ ELGHHAGYY++ HS+AAR Sbjct: 52 LFPKSSINIPENDPHVLHGNIVEKKFTFPGFDDSGYSVEELGHHAGYYSLPHSKAAR 108 >ref|XP_004164209.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus] Length = 509 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +3 Query: 42 LSPSESKIVEKNFRFPGLADSGPSIAELGHHAGYYTIKHSRAAR 173 L+ E KIVE+ RFP DSG S+ ELGHHAGYY I+HS AAR Sbjct: 69 LAAGEKKIVERRLRFPLFDDSGVSLEELGHHAGYYKIEHSHAAR 112