BLASTX nr result
ID: Cimicifuga21_contig00009126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009126 (957 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19766.3| unnamed protein product [Vitis vinifera] 91 4e-16 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 90 9e-16 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 90 9e-16 ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 89 2e-15 gb|AFG48749.1| Pinus taeda anonymous locus 0_2087_01 genomic seq... 82 2e-13 >emb|CBI19766.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 90.9 bits (224), Expect = 4e-16 Identities = 37/65 (56%), Positives = 50/65 (76%) Frame = +3 Query: 3 AISFALISSPYSSQAIRIMKNFRMCSECHKTAKFISLKYGREVYLYDTKCFHRFKNGQCS 182 A++FALI + +++RI+KN RMC +CH TAKF+S+ Y E+YL D+KC H FKNG+CS Sbjct: 430 ALAFALIDPSCAPRSVRIVKNLRMCGDCHGTAKFLSMLYSCEIYLSDSKCLHWFKNGRCS 489 Query: 183 CRDYW 197 C DYW Sbjct: 490 CGDYW 494 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 89.7 bits (221), Expect = 9e-16 Identities = 38/66 (57%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = +3 Query: 3 AISFALISSPYSSQA-IRIMKNFRMCSECHKTAKFISLKYGREVYLYDTKCFHRFKNGQC 179 A++F LISS +S+ IRI+KN RMC +CH TAK++S +YG ++ L DT+C H FKNG C Sbjct: 829 AMAFGLISSSGASKTTIRILKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDC 888 Query: 180 SCRDYW 197 SC+DYW Sbjct: 889 SCKDYW 894 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 89.7 bits (221), Expect = 9e-16 Identities = 38/66 (57%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = +3 Query: 3 AISFALISSPYSSQA-IRIMKNFRMCSECHKTAKFISLKYGREVYLYDTKCFHRFKNGQC 179 A++F LISS +S+ IRI+KN RMC +CH TAK++S +YG ++ L DT+C H FKNG C Sbjct: 341 AMAFGLISSSGASKTTIRILKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDC 400 Query: 180 SCRDYW 197 SC+DYW Sbjct: 401 SCKDYW 406 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 887 Score = 89.0 bits (219), Expect = 2e-15 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = +3 Query: 3 AISFALISSPYSSQAIRIMKNFRMCSECHKTAKFISLKYGREVYLYDTKCFHRFKNGQCS 182 A +FALI Q +RI+K RMC +CH TAK+IS+ YG E+YL D+ C H FK G CS Sbjct: 823 AFAFALIDPHNKPQILRIVKKLRMCRDCHDTAKYISMAYGCEIYLSDSNCLHHFKGGHCS 882 Query: 183 CRDYW 197 CRDYW Sbjct: 883 CRDYW 887 >gb|AFG48749.1| Pinus taeda anonymous locus 0_2087_01 genomic sequence Length = 95 Score = 81.6 bits (200), Expect = 2e-13 Identities = 34/65 (52%), Positives = 49/65 (75%) Frame = +3 Query: 3 AISFALISSPYSSQAIRIMKNFRMCSECHKTAKFISLKYGREVYLYDTKCFHRFKNGQCS 182 A++F +I++P + +IR++KN R+C +CH KFIS Y RE+ L DTK FH FK+GQCS Sbjct: 32 AVAFGIINTPPRT-SIRVLKNLRVCGDCHSVIKFISKVYEREIILRDTKRFHHFKDGQCS 90 Query: 183 CRDYW 197 CR++W Sbjct: 91 CREFW 95