BLASTX nr result
ID: Cimicifuga21_contig00009035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009035 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN37685.1| SEP3 [Anemone nemorosa] 59 3e-07 gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea] 59 4e-07 >gb|ADN37685.1| SEP3 [Anemone nemorosa] Length = 140 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 161 ASICMLKTLERYQKCSYGGPKPNVSAREAQE 69 +S MLKTLERYQKCSYGGP+PNVSAREAQE Sbjct: 34 SSASMLKTLERYQKCSYGGPEPNVSAREAQE 64 >gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea] Length = 244 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 161 ASICMLKTLERYQKCSYGGPKPNVSAREAQE 69 +S MLKTLERYQKCSYGGP+PNVSAREAQE Sbjct: 59 SSSSMLKTLERYQKCSYGGPEPNVSAREAQE 89