BLASTX nr result
ID: Cimicifuga21_contig00008084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008084 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26021.3| unnamed protein product [Vitis vinifera] 70 2e-10 emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] 65 7e-09 ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 58 7e-07 dbj|BAJ85434.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 3e-06 >emb|CBI26021.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/77 (45%), Positives = 50/77 (64%) Frame = +1 Query: 13 VRNILSNCSFLEWFSIGRCFCPSPTSLEFAGPSLHLKHLSVCGCFNLLGIEVEAANLVSF 192 ++++LS CS LEW S+ C C +L F+ +L LK LS+ CF L IE+ AA+LV+F Sbjct: 218 LQDLLSTCSHLEWLSL--CVCNGLVNLSFSALNLQLKFLSIKNCFRLETIEIHAADLVTF 275 Query: 193 EYRGPLLRLSFNNVPRV 243 +Y G L SF NVP++ Sbjct: 276 KYGGHLPSFSFKNVPKL 292 >emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] Length = 1789 Score = 64.7 bits (156), Expect = 7e-09 Identities = 34/77 (44%), Positives = 49/77 (63%) Frame = +1 Query: 13 VRNILSNCSFLEWFSIGRCFCPSPTSLEFAGPSLHLKHLSVCGCFNLLGIEVEAANLVSF 192 ++++LS CS LE S+ C C +L F+ +L LK LS+ CF L IE+ AA+LV+F Sbjct: 1520 LQDLLSTCSHLERLSL--CVCNGLVNLSFSALNLQLKFLSIKNCFRLETIEIHAADLVTF 1577 Query: 193 EYRGPLLRLSFNNVPRV 243 +Y G L SF NVP++ Sbjct: 1578 KYGGHLPSFSFKNVPKL 1594 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 58.2 bits (139), Expect = 7e-07 Identities = 36/82 (43%), Positives = 52/82 (63%), Gaps = 1/82 (1%) Frame = +1 Query: 1 TGKGVRNIL-SNCSFLEWFSIGRCFCPSPTSLEFAGPSLHLKHLSVCGCFNLLGIEVEAA 177 TG+ ++++L S C LE SI S SL+ +G SL LK+L + C NL +E+ AA Sbjct: 194 TGEALQHLLLSWCPLLEVLSIVNS--TSLVSLKVSGSSLKLKYLEMVCCNNLKYLEITAA 251 Query: 178 NLVSFEYRGPLLRLSFNNVPRV 243 +LVSF+Y GPL+ L F +VP + Sbjct: 252 SLVSFKYYGPLIGLPFKSVPNL 273 >dbj|BAJ85434.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 444 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = +1 Query: 1 TGKGVRNILSNCSFLEWFSIGRCFCPSPTSLEFAGPSLHLKHLSVCGCFNLLGIEVEAAN 180 +GK ++++LSNC LEW SI RC L+ GP HL +L + C L I A N Sbjct: 296 SGKDIQHMLSNCCNLEWLSIVRCHLNG--ELKVNGPLPHLLYLKIASC-RLTNIAFNAVN 352 Query: 181 LVSFEYRG 204 L +FEYRG Sbjct: 353 LATFEYRG 360