BLASTX nr result
ID: Cimicifuga21_contig00006778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00006778 (646 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P17569.1|NIA_CUCMA RecName: Full=Nitrate reductase [NADH]; Sh... 55 9e-06 >sp|P17569.1|NIA_CUCMA RecName: Full=Nitrate reductase [NADH]; Short=NR gi|167499|gb|AAA33114.1| nitrate reductase [Cucurbita maxima] Length = 918 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +3 Query: 531 KALDETQHTSRKAYLESHEGMMNNCWFRVETNMCKPHK 644 +A DET +T + + + GMMNNCWFRV+TNMCKPHK Sbjct: 456 RAWDETHNTQPEKLIWNLMGMMNNCWFRVKTNMCKPHK 493