BLASTX nr result
ID: Cimicifuga21_contig00005273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00005273 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515867.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002867547.1| hypothetical protein ARALYDRAFT_913883 [Arab... 56 3e-06 >ref|XP_002515867.1| conserved hypothetical protein [Ricinus communis] gi|223545022|gb|EEF46536.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 398 GICLFSVGAHLSYVNIAPQQARAKARKDFVREYFEKKYGK 279 G LF+VG+ LSYVN+APQQAR KAR DFV+E KK+GK Sbjct: 11 GAALFAVGSRLSYVNVAPQQARIKARNDFVKERLRKKHGK 50 >ref|XP_002867547.1| hypothetical protein ARALYDRAFT_913883 [Arabidopsis lyrata subsp. lyrata] gi|297313383|gb|EFH43806.1| hypothetical protein ARALYDRAFT_913883 [Arabidopsis lyrata subsp. lyrata] Length = 61 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 398 GICLFSVGAHLSYVNIAPQQARAKARKDFVREYFEKKYGK 279 G LF++G H SY+N+APQQAR KAR DFV+E +K GK Sbjct: 22 GAALFAIGIHFSYLNVAPQQARTKARNDFVKERLRQKQGK 61