BLASTX nr result
ID: Cimicifuga21_contig00001118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00001118 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF06565.1| translational initiation factor eIF1 [Elaeis guin... 55 8e-06 >gb|ACF06565.1| translational initiation factor eIF1 [Elaeis guineensis] Length = 113 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 216 MSEVEVQIPTTFDPFAEATADDSSAGSKEYV 308 MS++ VQ+PTTFDPFAEA ADDS AG+KEYV Sbjct: 1 MSDLNVQLPTTFDPFAEANADDSGAGAKEYV 31