BLASTX nr result
ID: Cimicifuga21_contig00000842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00000842 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256... 74 1e-11 emb|CBI27125.3| unnamed protein product [Vitis vinifera] 74 1e-11 ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256... 74 1e-11 ref|XP_002514531.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_002311406.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 >ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256033 isoform 2 [Vitis vinifera] Length = 140 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 311 YTIFGTLLLLNCGFFVFLLHILYAVFFNRIGMRDSLTLPSWFMKAL 174 Y +FGTLLLLN GFFVFLLHILYAVF +R+GM+ SLT+P W KA+ Sbjct: 95 YALFGTLLLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 140 >emb|CBI27125.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 311 YTIFGTLLLLNCGFFVFLLHILYAVFFNRIGMRDSLTLPSWFMKAL 174 Y +FGTLLLLN GFFVFLLHILYAVF +R+GM+ SLT+P W KA+ Sbjct: 147 YALFGTLLLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 192 >ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256033 isoform 1 [Vitis vinifera] Length = 286 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 311 YTIFGTLLLLNCGFFVFLLHILYAVFFNRIGMRDSLTLPSWFMKAL 174 Y +FGTLLLLN GFFVFLLHILYAVF +R+GM+ SLT+P W KA+ Sbjct: 241 YALFGTLLLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 286 >ref|XP_002514531.1| conserved hypothetical protein [Ricinus communis] gi|223546135|gb|EEF47637.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 311 YTIFGTLLLLNCGFFVFLLHILYAVFFNRIGMRDSLTLPSWFMKAL 174 YT+FG L+LLN G FVFLLH+LY+VFF R+GM+DSL LP W KAL Sbjct: 260 YTLFGILVLLNSGSFVFLLHLLYSVFFTRLGMKDSLRLPRWLEKAL 305 >ref|XP_002311406.1| predicted protein [Populus trichocarpa] gi|222851226|gb|EEE88773.1| predicted protein [Populus trichocarpa] Length = 306 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 311 YTIFGTLLLLNCGFFVFLLHILYAVFFNRIGMRDSLTLPSWFMKAL 174 Y++FG L++LN GFFVFLLH+LY+VF R+GM+DSL LP W KAL Sbjct: 261 YSLFGILVVLNSGFFVFLLHLLYSVFLTRLGMKDSLRLPRWLEKAL 306