BLASTX nr result
ID: Chrysanthemum21_contig00038135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038135 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772680.1| exocyst complex component EXO70A1-like [Lact... 79 4e-14 ref|XP_023734473.1| exocyst complex component EXO70A1-like [Lact... 77 3e-13 gb|KVH97909.1| Cullin repeat-like-containing domain-containing p... 76 4e-13 ref|XP_021903004.1| exocyst complex component EXO70A1 [Carica pa... 74 3e-12 ref|XP_017258173.1| PREDICTED: exocyst complex component EXO70A1... 73 6e-12 ref|XP_021984559.1| exocyst complex component EXO70A1 [Helianthu... 73 6e-12 ref|XP_022033524.1| exocyst complex component EXO70A1-like [Heli... 73 6e-12 ref|XP_018835039.1| PREDICTED: exocyst complex component EXO70A1... 72 8e-12 ref|XP_004305761.1| PREDICTED: exocyst complex component EXO70A1... 72 8e-12 ref|XP_024180827.1| exocyst complex component EXO70A1 [Rosa chin... 72 8e-12 ref|XP_012856702.1| PREDICTED: exocyst complex component EXO70A1... 72 1e-11 gb|OMO70613.1| Exocyst complex protein Exo70 [Corchorus capsularis] 72 1e-11 gb|OMO66074.1| Exocyst complex protein Exo70 [Corchorus olitorius] 72 1e-11 gb|KCW68861.1| hypothetical protein EUGRSUZ_F02455 [Eucalyptus g... 72 1e-11 ref|XP_017218478.1| PREDICTED: exocyst complex component EXO70A1... 71 2e-11 ref|XP_010111987.1| exocyst complex component EXO70A1 [Morus not... 71 2e-11 ref|XP_008228355.1| PREDICTED: exocyst complex component EXO70A1... 71 2e-11 ref|XP_021638907.1| exocyst complex component EXO70A1-like [Heve... 71 2e-11 ref|XP_021294465.1| exocyst complex component EXO70A1-like [Herr... 71 2e-11 ref|XP_017979394.1| PREDICTED: exocyst complex component EXO70A1... 71 2e-11 >ref|XP_023772680.1| exocyst complex component EXO70A1-like [Lactuca sativa] gb|PLY78633.1| hypothetical protein LSAT_4X92560 [Lactuca sativa] Length = 628 Score = 79.0 bits (193), Expect = 4e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+G+HPE YIKYSVEDLETAVLDFFEGCAVSQ SRRRS Sbjct: 586 RSHIESGRHPENYIKYSVEDLETAVLDFFEGCAVSQHSRRRS 627 >ref|XP_023734473.1| exocyst complex component EXO70A1-like [Lactuca sativa] gb|PLY97254.1| hypothetical protein LSAT_1X37860 [Lactuca sativa] Length = 626 Score = 76.6 bits (187), Expect = 3e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIENG+HPE YIKYSVEDLETAVLDFFEG AVSQ SRRRS Sbjct: 584 RTHIENGRHPEQYIKYSVEDLETAVLDFFEGYAVSQHSRRRS 625 >gb|KVH97909.1| Cullin repeat-like-containing domain-containing protein [Cynara cardunculus var. scolymus] Length = 622 Score = 76.3 bits (186), Expect = 4e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIENG+HPE YIKYSVEDLETAVLDFFEG AVSQ SRRRS Sbjct: 580 RTHIENGRHPENYIKYSVEDLETAVLDFFEGYAVSQHSRRRS 621 >ref|XP_021903004.1| exocyst complex component EXO70A1 [Carica papaya] Length = 632 Score = 73.6 bits (179), Expect = 3e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG +VSQ +RRRS Sbjct: 590 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYSVSQHTRRRS 631 >ref|XP_017258173.1| PREDICTED: exocyst complex component EXO70A1-like [Daucus carota subsp. sativus] gb|KZM89966.1| hypothetical protein DCAR_022669 [Daucus carota subsp. sativus] Length = 613 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIE+G+HPE YIKYSVEDLE AVLDFFEG VSQLSRRRS Sbjct: 571 RTHIESGRHPENYIKYSVEDLENAVLDFFEGNPVSQLSRRRS 612 >ref|XP_021984559.1| exocyst complex component EXO70A1 [Helianthus annuus] Length = 618 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIE+G+HPE YIKYSVEDLETA+LDFFEG AVSQ SRRRS Sbjct: 576 RTHIESGRHPENYIKYSVEDLETALLDFFEGNAVSQHSRRRS 617 >ref|XP_022033524.1| exocyst complex component EXO70A1-like [Helianthus annuus] gb|OTG26920.1| putative exocyst subunit exo70 family protein D1 [Helianthus annuus] Length = 639 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIE+G+HPE YIKYSVEDLETAVLDFFEG AV+Q SRRRS Sbjct: 596 RTHIEHGRHPENYIKYSVEDLETAVLDFFEGNAVNQHSRRRS 637 >ref|XP_018835039.1| PREDICTED: exocyst complex component EXO70A1-like [Juglans regia] Length = 618 Score = 72.4 bits (176), Expect = 8e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 ++HIENGKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 576 KSHIENGKHPENYIKYSVEDLETAVLDFFEGYQVSQHLRRRS 617 >ref|XP_004305761.1| PREDICTED: exocyst complex component EXO70A1 [Fragaria vesca subsp. vesca] Length = 623 Score = 72.4 bits (176), Expect = 8e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG +VSQ RRRS Sbjct: 581 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYSVSQHLRRRS 622 >ref|XP_024180827.1| exocyst complex component EXO70A1 [Rosa chinensis] gb|PRQ51609.1| putative exocyst complex component Exo70, cullin repeat-like-containing domain-containing protein [Rosa chinensis] Length = 633 Score = 72.4 bits (176), Expect = 8e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG +VSQ RRRS Sbjct: 591 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYSVSQHLRRRS 632 >ref|XP_012856702.1| PREDICTED: exocyst complex component EXO70A1-like [Erythranthe guttata] gb|EYU21299.1| hypothetical protein MIMGU_mgv1a003166mg [Erythranthe guttata] Length = 603 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+G+HPE YIKYSV+DLE AVLDFFEGC VSQ RRRS Sbjct: 561 RSHIESGRHPENYIKYSVDDLENAVLDFFEGCPVSQHLRRRS 602 >gb|OMO70613.1| Exocyst complex protein Exo70 [Corchorus capsularis] Length = 626 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 584 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYPVSQHLRRRS 625 >gb|OMO66074.1| Exocyst complex protein Exo70 [Corchorus olitorius] Length = 626 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 584 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYPVSQHLRRRS 625 >gb|KCW68861.1| hypothetical protein EUGRSUZ_F02455 [Eucalyptus grandis] Length = 634 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 592 RSHIESGKHPENYIKYSVEDLETAVLDFFEGYPVSQHLRRRS 633 >ref|XP_017218478.1| PREDICTED: exocyst complex component EXO70A1-like [Daucus carota subsp. sativus] gb|KZM89346.1| hypothetical protein DCAR_026421 [Daucus carota subsp. sativus] Length = 600 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+G+HPE YIKYSVEDLET+VLDFFEG VSQ SRRRS Sbjct: 558 RSHIESGRHPENYIKYSVEDLETSVLDFFEGNPVSQHSRRRS 599 >ref|XP_010111987.1| exocyst complex component EXO70A1 [Morus notabilis] gb|EXC32298.1| Exocyst complex component 7 [Morus notabilis] Length = 611 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R HIE+GKHPE YIKYS EDLE AVLDFFEGC VSQ RRRS Sbjct: 569 RNHIESGKHPENYIKYSAEDLENAVLDFFEGCPVSQHLRRRS 610 >ref|XP_008228355.1| PREDICTED: exocyst complex component EXO70A1-like [Prunus mume] Length = 613 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+G+HPE YIKYSVEDLETAVLDFFEG +VSQ RRRS Sbjct: 571 RSHIESGRHPENYIKYSVEDLETAVLDFFEGYSVSQHLRRRS 612 >ref|XP_021638907.1| exocyst complex component EXO70A1-like [Hevea brasiliensis] Length = 616 Score = 71.2 bits (173), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE Y+KYSVEDLE+AVLDFFEG VSQL RRRS Sbjct: 574 RSHIESGKHPENYMKYSVEDLESAVLDFFEGYHVSQLLRRRS 615 >ref|XP_021294465.1| exocyst complex component EXO70A1-like [Herrania umbratica] Length = 620 Score = 71.2 bits (173), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 578 RSHIESGKHPENYIKYSVEDLETAVLDFFEGNPVSQHLRRRS 619 >ref|XP_017979394.1| PREDICTED: exocyst complex component EXO70A1 [Theobroma cacao] Length = 620 Score = 71.2 bits (173), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 RAHIENGKHPEYYIKYSVEDLETAVLDFFEGCAVSQLSRRRS 128 R+HIE+GKHPE YIKYSVEDLETAVLDFFEG VSQ RRRS Sbjct: 578 RSHIESGKHPENYIKYSVEDLETAVLDFFEGNPVSQHLRRRS 619