BLASTX nr result
ID: Chrysanthemum21_contig00026148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00026148 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021982977.1| ATPase family AAA domain-containing protein ... 72 2e-11 ref|XP_015576292.1| PREDICTED: ATPase family AAA domain-containi... 68 5e-10 ref|XP_002521571.1| PREDICTED: ATPase family AAA domain-containi... 68 5e-10 gb|KVH92357.1| AAA+ ATPase domain-containing protein [Cynara car... 68 5e-10 ref|XP_012076141.1| ATPase family AAA domain-containing protein ... 67 9e-10 ref|XP_021638978.1| ATPase family AAA domain-containing protein ... 66 3e-09 gb|ESR38901.1| hypothetical protein CICLE_v10025141mg [Citrus cl... 65 5e-09 ref|XP_021907877.1| ATPase family AAA domain-containing protein ... 65 5e-09 gb|KDO79577.1| hypothetical protein CISIN_1g006700mg [Citrus sin... 65 5e-09 dbj|GAY42688.1| hypothetical protein CUMW_068830 [Citrus unshiu] 65 6e-09 ref|XP_008241689.1| PREDICTED: LOW QUALITY PROTEIN: ATPase famil... 65 6e-09 ref|XP_002266534.1| PREDICTED: ATPase family AAA domain-containi... 65 6e-09 ref|XP_010254803.1| PREDICTED: ATPase family AAA domain-containi... 65 6e-09 ref|XP_021907876.1| ATPase family AAA domain-containing protein ... 65 6e-09 dbj|GAY42689.1| hypothetical protein CUMW_068830 [Citrus unshiu]... 65 6e-09 gb|KDO79576.1| hypothetical protein CISIN_1g006700mg [Citrus sin... 65 6e-09 ref|XP_010029790.1| PREDICTED: ATPase family AAA domain-containi... 65 6e-09 ref|XP_006425662.1| ATPase family AAA domain-containing protein ... 65 6e-09 emb|CBI17506.3| unnamed protein product, partial [Vitis vinifera] 65 6e-09 dbj|GAY42687.1| hypothetical protein CUMW_068830 [Citrus unshiu] 65 6e-09 >ref|XP_021982977.1| ATPase family AAA domain-containing protein 3 [Helianthus annuus] gb|OTG15549.1| putative AAA-type ATPase family protein [Helianthus annuus] Length = 624 Score = 72.4 bits (176), Expect = 2e-11 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC+LDSQLFMEIVDYKVGEH QRIELA AGSQ A Sbjct: 586 VYGRPDCSLDSQLFMEIVDYKVGEHHQRIELANAGSQLA 624 >ref|XP_015576292.1| PREDICTED: ATPase family AAA domain-containing protein 3 isoform X2 [Ricinus communis] Length = 512 Score = 68.2 bits (165), Expect = 5e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF E+VDYKV EH QRI+LA GSQPA Sbjct: 474 VYGRPDCVLDSQLFREVVDYKVAEHHQRIKLAAEGSQPA 512 >ref|XP_002521571.1| PREDICTED: ATPase family AAA domain-containing protein 3C isoform X1 [Ricinus communis] gb|EEF40842.1| Protein MSP1, putative [Ricinus communis] Length = 626 Score = 68.2 bits (165), Expect = 5e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF E+VDYKV EH QRI+LA GSQPA Sbjct: 588 VYGRPDCVLDSQLFREVVDYKVAEHHQRIKLAAEGSQPA 626 >gb|KVH92357.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 629 Score = 68.2 bits (165), Expect = 5e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF+EIVDYKVGEH QR+ELA AG+Q A Sbjct: 591 VYGRPDCDLDSQLFLEIVDYKVGEHHQRLELANAGNQLA 629 >ref|XP_012076141.1| ATPase family AAA domain-containing protein 3 [Jatropha curcas] gb|KDP34401.1| hypothetical protein JCGZ_12805 [Jatropha curcas] Length = 625 Score = 67.4 bits (163), Expect = 9e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF E+VDYKV EH QR++LA GSQPA Sbjct: 587 VYGRPDCVLDSQLFREVVDYKVAEHHQRLKLAAEGSQPA 625 >ref|XP_021638978.1| ATPase family AAA domain-containing protein 3C-like [Hevea brasiliensis] Length = 635 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF E+VD+KV EH QRI+LA GSQPA Sbjct: 597 VYGRPDCVLDSQLFREVVDFKVAEHHQRIKLAEEGSQPA 635 >gb|ESR38901.1| hypothetical protein CICLE_v10025141mg [Citrus clementina] Length = 513 Score = 65.1 bits (157), Expect = 5e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 472 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 513 >ref|XP_021907877.1| ATPase family AAA domain-containing protein 3 isoform X2 [Carica papaya] Length = 514 Score = 65.1 bits (157), Expect = 5e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF EI+DYKV EH +R++LA GSQPA Sbjct: 472 VYGRPDCVLDSQLFREILDYKVAEHHRRVKLAADGSQPA 510 >gb|KDO79577.1| hypothetical protein CISIN_1g006700mg [Citrus sinensis] Length = 523 Score = 65.1 bits (157), Expect = 5e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 482 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 523 >dbj|GAY42688.1| hypothetical protein CUMW_068830 [Citrus unshiu] Length = 614 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 573 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 614 >ref|XP_008241689.1| PREDICTED: LOW QUALITY PROTEIN: ATPase family AAA domain-containing protein 3 [Prunus mume] Length = 617 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF EIVDYKV EH QRI+LA G PA Sbjct: 579 VYGRPDCVLDSQLFKEIVDYKVAEHHQRIKLAAEGGHPA 617 >ref|XP_002266534.1| PREDICTED: ATPase family AAA domain-containing protein 3 [Vitis vinifera] Length = 627 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLFMEIVDYKV EH QR++L G PA Sbjct: 589 VYGRPDCVLDSQLFMEIVDYKVAEHHQRLKLVAEGGHPA 627 >ref|XP_010254803.1| PREDICTED: ATPase family AAA domain-containing protein 3-A-like [Nelumbo nucifera] Length = 629 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LD QLFMEIVDYKV EH+QRI+LA GSQ A Sbjct: 591 VYGRPDCILDLQLFMEIVDYKVAEHQQRIKLAAEGSQLA 629 >ref|XP_021907876.1| ATPase family AAA domain-containing protein 3 isoform X1 [Carica papaya] Length = 632 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLF EI+DYKV EH +R++LA GSQPA Sbjct: 590 VYGRPDCVLDSQLFREILDYKVAEHHRRVKLAADGSQPA 628 >dbj|GAY42689.1| hypothetical protein CUMW_068830 [Citrus unshiu] dbj|GAY42690.1| hypothetical protein CUMW_068840 [Citrus unshiu] Length = 635 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 594 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 635 >gb|KDO79576.1| hypothetical protein CISIN_1g006700mg [Citrus sinensis] Length = 635 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 594 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 635 >ref|XP_010029790.1| PREDICTED: ATPase family AAA domain-containing protein 3 [Eucalyptus grandis] gb|KCW56749.1| hypothetical protein EUGRSUZ_I02432 [Eucalyptus grandis] Length = 635 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LD+ LF EIV+YKVGEH+QRI+LA G QPA Sbjct: 597 VYGRPDCVLDADLFKEIVEYKVGEHQQRIKLAANGGQPA 635 >ref|XP_006425662.1| ATPase family AAA domain-containing protein 3 [Citrus clementina] ref|XP_006466806.1| PREDICTED: ATPase family AAA domain-containing protein 3-like [Citrus sinensis] gb|ESR38902.1| hypothetical protein CICLE_v10025141mg [Citrus clementina] Length = 635 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 594 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 635 >emb|CBI17506.3| unnamed protein product, partial [Vitis vinifera] Length = 649 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPA 119 VYGRPDC LDSQLFMEIVDYKV EH QR++L G PA Sbjct: 611 VYGRPDCVLDSQLFMEIVDYKVAEHHQRLKLVAEGGHPA 649 >dbj|GAY42687.1| hypothetical protein CUMW_068830 [Citrus unshiu] Length = 651 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +3 Query: 3 VYGRPDCALDSQLFMEIVDYKVGEHKQRIELALAGSQPAKAQ 128 VY RPDC LDSQLF E+V+YKV EH QRI+LA GSQP K Q Sbjct: 610 VYARPDCVLDSQLFREVVEYKVEEHHQRIKLAAEGSQPTKNQ 651