BLASTX nr result
ID: Chrysanthemum21_contig00017495
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017495 (611 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG23794.1| putative RNA-binding (RRM/RBD/RNP motifs) family ... 54 1e-07 ref|XP_021677014.1| polyadenylate-binding protein RBP45C-like is... 59 1e-06 gb|OVA06612.1| RNA recognition motif domain [Macleaya cordata] 56 9e-06 >gb|OTG23794.1| putative RNA-binding (RRM/RBD/RNP motifs) family protein [Helianthus annuus] Length = 382 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -1 Query: 191 CAE*ALIMLQGTQFGGQTIRLSWGRSPTS*QESKAST 81 CAE AL LQGTQFGGQT+RLSWGRSP++ Q S T Sbjct: 336 CAEEALRTLQGTQFGGQTVRLSWGRSPSNKQVSSGRT 372 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 97 RAKPVLWWILWV 62 R KPV WWILWV Sbjct: 371 RTKPVQWWILWV 382 >ref|XP_021677014.1| polyadenylate-binding protein RBP45C-like isoform X1 [Hevea brasiliensis] Length = 421 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/62 (53%), Positives = 40/62 (64%), Gaps = 9/62 (14%) Frame = -1 Query: 191 CAE*ALIMLQGTQFGGQTIRLSWGRSPTS*Q---------ESKASTMVDTMGMDKYLKLM 39 CAE AL+ML GTQ GQ+IRLSWGRSP++ Q ++KAS M D M M K + M Sbjct: 322 CAEQALLMLNGTQLAGQSIRLSWGRSPSNKQASIGRSRLSQNKASGMEDIMAMHKDMMHM 381 Query: 38 DM 33 DM Sbjct: 382 DM 383 >gb|OVA06612.1| RNA recognition motif domain [Macleaya cordata] Length = 441 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 191 CAE*ALIMLQGTQFGGQTIRLSWGRSPTS*QESKASTMV 75 CAE AL+MLQGTQ GGQ IRLSWGRSP++ Q+ ++ MV Sbjct: 333 CAEEALLMLQGTQLGGQNIRLSWGRSPSNKQQDPSAGMV 371