BLASTX nr result
ID: Cheilocostus21_contig00049675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00049675 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416920.1| PREDICTED: uncharacterized protein LOC103997... 68 4e-10 >ref|XP_009416920.1| PREDICTED: uncharacterized protein LOC103997435 [Musa acuminata subsp. malaccensis] ref|XP_018674137.1| PREDICTED: uncharacterized protein LOC103997435 [Musa acuminata subsp. malaccensis] Length = 649 Score = 68.2 bits (165), Expect = 4e-10 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 12/77 (15%) Frame = +2 Query: 266 MGVFCSKIIVVGRSPSEITLQN-----FAISYEYNGKEQGAYKTMPVEQTNKEFNNDSY- 427 MGVFCSK+ VV RSPSEITLQN +A YE +GK QG YKT+P E+ K+ + D Y Sbjct: 1 MGVFCSKMAVVDRSPSEITLQNGFGGQYAFPYETHGKGQGIYKTLPREEPKKQLSEDPYP 60 Query: 428 ------LGFIDSGVGKP 460 G I+S +P Sbjct: 61 FAAMDGFGIIESRAVEP 77