BLASTX nr result
ID: Cheilocostus21_contig00049539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00049539 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposo... 57 2e-06 >gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1311 Score = 57.4 bits (137), Expect = 2e-06 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 3/131 (2%) Frame = +1 Query: 124 HISPTTLLRQSVG---HDLIIAKMELMETPPTTVDEKYTPNDELQISDKNTHISFFDMQN 294 H +T+L +S HD II K PP V ++ T + LQ++ + ++ Sbjct: 692 HPESSTILPKSFNISPHDPIIEK------PPQPVIQETTDHTPLQLTSTDESAFSQRTKH 745 Query: 295 NTRRSLRNKKAPNYLKEYHIELSLRTRQILDHHSCC*TCQHQYSLSSMLSYDRVTPSQ*T 474 RRS R K AP YL++YH LS ++ + +Y LSS+LSY R++ + Sbjct: 746 EPRRSTRPKHAPTYLQDYHHSLSSHDTKV--------STSSRYPLSSVLSYSRLSHTHKH 797 Query: 475 LVTSISTTREP 507 V SIS+T EP Sbjct: 798 FVMSISSTVEP 808