BLASTX nr result
ID: Cheilocostus21_contig00049517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00049517 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEH04447.1| granule-bound starch synthase, partial [Eleusine ... 61 6e-09 gb|AEH04446.1| granule-bound starch synthase, partial [Eleusine ... 61 6e-09 gb|AFL70623.1| granule-bound starch synthase, partial [Neololeba... 61 1e-08 gb|ACS36515.1| waxy, partial [Centotheca lappacea] 63 2e-08 gb|ADE09330.1| granule bound starch synthase I, partial [Giganto... 60 2e-08 gb|ADE09329.1| granule bound starch synthase I, partial [Giganto... 60 2e-08 gb|ADE09328.1| granule bound starch synthase I, partial [Giganto... 60 2e-08 gb|ADE09327.1| granule bound starch synthase I, partial [Giganto... 60 2e-08 gb|ADE09342.1| granule bound starch synthase I, partial [Schizos... 60 2e-08 gb|ADE09340.1| granule bound starch synthase I, partial [Bambusa... 60 2e-08 gb|ADE09337.1| granule bound starch synthase I, partial [Bambusa... 60 2e-08 gb|ADE09336.1| granule bound starch synthase I, partial [Sphaero... 60 2e-08 gb|ADE09334.1| granule bound starch synthase I, partial [Melocan... 60 2e-08 gb|ADE09333.1| granule bound starch synthase I, partial [Macluro... 60 2e-08 gb|ADE09332.1| granule bound starch synthase I, partial [Kinabal... 60 2e-08 gb|ADE09331.1| granule bound starch synthase I, partial [Holttum... 60 2e-08 gb|ADE09325.1| granule bound starch synthase I, partial [Dinochl... 60 2e-08 gb|ADE09324.1| granule bound starch synthase I, partial [Dendroc... 60 2e-08 gb|ADE09322.1| granule bound starch synthase I, partial [Bambusa... 60 2e-08 gb|ADE09320.1| granule bound starch synthase I, partial [Bambusa... 60 2e-08 >gb|AEH04447.1| granule-bound starch synthase, partial [Eleusine coracana] Length = 93 Score = 60.8 bits (146), Expect = 6e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVCS 478 IMAGADLL V SRFEPCGLIQLQGMRYGT C+ Sbjct: 36 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPCA 67 >gb|AEH04446.1| granule-bound starch synthase, partial [Eleusine coracana] Length = 93 Score = 60.8 bits (146), Expect = 6e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVCS 478 IMAGADLL V SRFEPCGLIQLQGMRYGT C+ Sbjct: 36 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPCA 67 >gb|AFL70623.1| granule-bound starch synthase, partial [Neololeba atra] Length = 128 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVCS 478 IMAGADLL V SRFEPCGLIQLQGMRYGT C+ Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPCA 46 >gb|ACS36515.1| waxy, partial [Centotheca lappacea] Length = 254 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVCS 478 IMAGAD+L VPSRFEPCGLIQLQGMRYGT C+ Sbjct: 135 IMAGADVLAVPSRFEPCGLIQLQGMRYGTPCA 166 >gb|ADE09330.1| granule bound starch synthase I, partial [Gigantochloa wrayi] Length = 127 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09329.1| granule bound starch synthase I, partial [Gigantochloa ligulata] Length = 127 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09328.1| granule bound starch synthase I, partial [Gigantochloa latifolia] gb|AFL70618.1| granule-bound starch synthase, partial [Gigantochloa apus] Length = 127 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLTVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09327.1| granule bound starch synthase I, partial [Gigantochloa balui] Length = 127 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLTVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09342.1| granule bound starch synthase I, partial [Schizostachyum zollingeri] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLTVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09340.1| granule bound starch synthase I, partial [Bambusa valida] gb|AFL70609.1| granule-bound starch synthase, partial [Bambusa grandis] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09337.1| granule bound starch synthase I, partial [Bambusa gibba] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09336.1| granule bound starch synthase I, partial [Sphaerobambos hirsuta] gb|AFL70626.1| granule-bound starch synthase, partial [Racemobambos hepburnii] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09334.1| granule bound starch synthase I, partial [Melocanna baccifera] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09333.1| granule bound starch synthase I, partial [Maclurochloa montana] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09332.1| granule bound starch synthase I, partial [Kinabaluchloa nebulosa] gb|AFL70621.1| granule-bound starch synthase, partial [Kinabaluchloa wrayi] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09331.1| granule bound starch synthase I, partial [Holttumochloa magica] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09325.1| granule bound starch synthase I, partial [Dinochloa malayana] gb|ADE09326.1| granule bound starch synthase I, partial [Dinochloa sp. KLU Bambusetum Acc.13] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09324.1| granule bound starch synthase I, partial [Dendrocalamus strictus] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09322.1| granule bound starch synthase I, partial [Bambusa multiplex] gb|AFL70605.1| granule-bound starch synthase, partial [Bambusa boniopsis] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45 >gb|ADE09320.1| granule bound starch synthase I, partial [Bambusa farinacea] gb|ADE09321.1| granule bound starch synthase I, partial [Bambusa flexuosa] gb|ADE09323.1| granule bound starch synthase I, partial [Bambusa sinospinosa] gb|ADE09335.1| granule bound starch synthase I, partial [Soejatmia ridleyi] gb|ADE09338.1| granule bound starch synthase I, partial [Bambusa bambos] gb|ADE09339.1| granule bound starch synthase I, partial [Bambusa blumeana] gb|AFL70604.1| granule-bound starch synthase, partial [Bambusa bambos] gb|AFL70606.1| granule-bound starch synthase, partial [Bambusa burmanica] gb|AFL70608.1| granule-bound starch synthase, partial [Bambusa farinacea] Length = 128 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 573 IMAGADLLVVPSRFEPCGLIQLQGMRYGTVC 481 IMAGADLL V SRFEPCGLIQLQGMRYGT C Sbjct: 15 IMAGADLLAVTSRFEPCGLIQLQGMRYGTPC 45