BLASTX nr result
ID: Cheilocostus21_contig00044272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044272 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM96181.1| hypothetical protein AMTR_s00001p00084840 [Ambore... 64 1e-10 ref|WP_071414391.1| 30S ribosomal protein S4, partial [Acinetoba... 65 2e-10 gb|KCW56191.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus g... 65 2e-10 gb|KRH63368.1| hypothetical protein GLYMA_04G171400 [Glycine max] 66 2e-10 gb|PIA25537.1| hypothetical protein AQUCO_11100009v1 [Aquilegia ... 67 2e-10 gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus g... 65 3e-10 ref|XP_018421592.1| PREDICTED: 40S ribosomal protein S9 isoform ... 65 3e-10 ref|XP_016455820.1| PREDICTED: 40S ribosomal protein S9 [Nicotia... 64 5e-10 gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus g... 65 5e-10 gb|PIA64509.1| hypothetical protein AQUCO_00100174v1 [Aquilegia ... 65 5e-10 gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus g... 65 6e-10 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus cl... 65 6e-10 gb|PON57336.1| Ribosomal protein [Parasponia andersonii] >gi|133... 65 8e-10 gb|KMZ73608.1| 40S ribosomal protein S9-2 [Zostera marina] 65 8e-10 gb|OIW00005.1| hypothetical protein TanjilG_26342 [Lupinus angus... 65 8e-10 ref|XP_002517490.1| PREDICTED: 40S ribosomal protein S9-2 [Ricin... 65 8e-10 ref|XP_002522398.1| PREDICTED: 40S ribosomal protein S9-2 [Ricin... 65 8e-10 ref|XP_024018555.1| 40S ribosomal protein S9-2 [Morus notabilis]... 65 8e-10 gb|PON70376.1| Ribosomal protein [Parasponia andersonii] 65 8e-10 gb|PON67078.1| Ribosomal protein [Trema orientalis] 65 8e-10 >gb|ERM96181.1| hypothetical protein AMTR_s00001p00084840 [Amborella trichopoda] Length = 81 Score = 64.3 bits (155), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQT+VFKSGMAKSIHHARVLIRQRHIRV Sbjct: 48 LERRLQTIVFKSGMAKSIHHARVLIRQRHIRV 79 >ref|WP_071414391.1| 30S ribosomal protein S4, partial [Acinetobacter baumannii] gb|OIC78814.1| 30S ribosomal protein S4, partial [Acinetobacter baumannii] Length = 114 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 26 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 57 >gb|KCW56191.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis] Length = 116 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 26 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 57 >gb|KRH63368.1| hypothetical protein GLYMA_04G171400 [Glycine max] Length = 183 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRVD 99 LERRLQTLVFKSGMAKSIHHARVLI+QRHIRVD Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIKQRHIRVD 139 >gb|PIA25537.1| hypothetical protein AQUCO_11100009v1 [Aquilegia coerulea] gb|PIA25538.1| hypothetical protein AQUCO_11100009v1 [Aquilegia coerulea] gb|PIA25539.1| hypothetical protein AQUCO_11100009v1 [Aquilegia coerulea] Length = 204 Score = 66.6 bits (161), Expect = 2e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRVDYLV 108 LERRLQTLVFKSGMAKSIHHARVLIRQRHIR+ +L+ Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRLVFLI 142 >gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis] Length = 140 Score = 65.1 bits (157), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >ref|XP_018421592.1| PREDICTED: 40S ribosomal protein S9 isoform X2 [Nanorana parkeri] Length = 166 Score = 65.5 bits (158), Expect = 3e-10 Identities = 34/51 (66%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV---DYLVWRHGWGDSLWRC 144 LERRLQT VFK G+AKSIHHARVLIRQRHIR+ +L W+ SLW C Sbjct: 106 LERRLQTQVFKLGLAKSIHHARVLIRQRHIRMLMSPFLKWKLDSARSLWFC 156 >ref|XP_016455820.1| PREDICTED: 40S ribosomal protein S9 [Nicotiana tabacum] Length = 116 Score = 63.9 bits (154), Expect = 5e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFK+GMAKSIHHARVLIRQRHIRV Sbjct: 26 LERRLQTLVFKTGMAKSIHHARVLIRQRHIRV 57 >gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis] Length = 164 Score = 65.1 bits (157), Expect = 5e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 74 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 105 >gb|PIA64509.1| hypothetical protein AQUCO_00100174v1 [Aquilegia coerulea] Length = 152 Score = 64.7 bits (156), Expect = 5e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRVDYLVW 111 LER LQTLVFKSGMAKSIHHARVLIRQRHIR + W Sbjct: 107 LERHLQTLVFKSGMAKSIHHARVLIRQRHIREQLVCW 143 >gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis] Length = 176 Score = 65.1 bits (157), Expect = 6e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina] Length = 178 Score = 65.1 bits (157), Expect = 6e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 88 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 119 >gb|PON57336.1| Ribosomal protein [Parasponia andersonii] gb|PON93633.1| Ribosomal protein [Trema orientalis] Length = 191 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 101 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 132 >gb|KMZ73608.1| 40S ribosomal protein S9-2 [Zostera marina] Length = 192 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 102 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 133 >gb|OIW00005.1| hypothetical protein TanjilG_26342 [Lupinus angustifolius] Length = 195 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 105 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 136 >ref|XP_002517490.1| PREDICTED: 40S ribosomal protein S9-2 [Ricinus communis] gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis] Length = 196 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >ref|XP_002522398.1| PREDICTED: 40S ribosomal protein S9-2 [Ricinus communis] gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis] Length = 196 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >ref|XP_024018555.1| 40S ribosomal protein S9-2 [Morus notabilis] gb|PON71929.1| Ribosomal protein [Parasponia andersonii] gb|PON83707.1| Ribosomal protein [Trema orientalis] Length = 197 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >gb|PON70376.1| Ribosomal protein [Parasponia andersonii] Length = 197 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138 >gb|PON67078.1| Ribosomal protein [Trema orientalis] Length = 197 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 96 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV Sbjct: 107 LERRLQTLVFKSGMAKSIHHARVLIRQRHIRV 138