BLASTX nr result
ID: Cheilocostus21_contig00007232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00007232 (1093 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OEL17748.1| Autophagy-related protein 8C [Dichanthelium oligo... 70 5e-11 gb|EOY28715.1| Ubiquitin-like superfamily protein isoform 2, par... 68 8e-11 gb|AAY67885.1| microtubule associated protein 1A/1B light chain ... 68 1e-10 gb|KJB56881.1| hypothetical protein B456_009G179100 [Gossypium r... 68 1e-10 gb|KQL00520.1| hypothetical protein SETIT_0146712mg, partial [Se... 68 1e-10 ref|XP_015583535.1| PREDICTED: autophagy-related protein 8f isof... 68 1e-10 gb|KRH51098.1| hypothetical protein GLYMA_07G261000 [Glycine max] 68 1e-10 gb|OEL27563.1| Autophagy-related protein 8C [Dichanthelium oligo... 68 2e-10 pdb|5L83|A Chain A, Complex Of Potato Atg8 Protein With A Peptid... 68 2e-10 gb|KXG27146.1| hypothetical protein SORBI_3006G220900 [Sorghum b... 68 2e-10 ref|XP_008661528.1| autophagy-related 8d isoform X2 [Zea mays] 68 2e-10 gb|ONM13705.1| Autophagy-related protein 8c [Zea mays] 68 2e-10 ref|XP_008385876.1| PREDICTED: autophagy-related protein 8C-like... 68 2e-10 gb|EPS63017.1| autophagy 8a, partial [Genlisea aurea] 68 2e-10 gb|EPS60837.1| autophagy 8a [Genlisea aurea] 68 2e-10 ref|XP_008226882.1| PREDICTED: autophagy-related protein 8C [Pru... 68 2e-10 ref|XP_023520342.1| autophagy-related protein 8C-like [Cucurbita... 68 2e-10 ref|XP_022994202.1| autophagy-related protein 8C-like [Cucurbita... 68 2e-10 ref|XP_022954812.1| autophagy-related protein 8C [Cucurbita mosc... 68 2e-10 gb|PIA57828.1| hypothetical protein AQUCO_00500029v1 [Aquilegia ... 68 2e-10 >gb|OEL17748.1| Autophagy-related protein 8C [Dichanthelium oligosanthes] Length = 131 Score = 70.1 bits (170), Expect = 5e-11 Identities = 38/61 (62%), Positives = 40/61 (65%) Frame = +3 Query: 909 CFQICSFRCPSCL*WTTXXXXXXXXXXXXKYPDRIPVIVEKAERSDIPDIDKKKYLVPAD 1088 CF I F SC+ + KYPDRIPVIVEKAERSDIPDIDKKKYLVPAD Sbjct: 10 CFGITEFS--SCMCHLSERRQAEANRIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPAD 67 Query: 1089 L 1091 L Sbjct: 68 L 68 >gb|EOY28715.1| Ubiquitin-like superfamily protein isoform 2, partial [Theobroma cacao] Length = 87 Score = 68.2 bits (165), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 24 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 55 >gb|AAY67885.1| microtubule associated protein 1A/1B light chain 3, partial [Saccharum hybrid cultivar B4362] Length = 101 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 7 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 38 >gb|KJB56881.1| hypothetical protein B456_009G179100 [Gossypium raimondii] Length = 90 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDR+PVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRVPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|KQL00520.1| hypothetical protein SETIT_0146712mg, partial [Setaria italica] gb|KQL00521.1| hypothetical protein SETIT_0146712mg, partial [Setaria italica] Length = 106 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 12 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 43 >ref|XP_015583535.1| PREDICTED: autophagy-related protein 8f isoform X2 [Ricinus communis] Length = 96 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDR+PVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRVPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|KRH51098.1| hypothetical protein GLYMA_07G261000 [Glycine max] Length = 109 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|OEL27563.1| Autophagy-related protein 8C [Dichanthelium oligosanthes] Length = 112 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 18 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 49 >pdb|5L83|A Chain A, Complex Of Potato Atg8 Protein With A Peptide From Irish Potato Famine Pathogen Effector Protein Pexrd54 pdb|5L83|B Chain B, Complex Of Potato Atg8 Protein With A Peptide From Irish Potato Famine Pathogen Effector Protein Pexrd54 Length = 112 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 23 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 54 >gb|KXG27146.1| hypothetical protein SORBI_3006G220900 [Sorghum bicolor] Length = 112 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 18 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 49 >ref|XP_008661528.1| autophagy-related 8d isoform X2 [Zea mays] Length = 112 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 18 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 49 >gb|ONM13705.1| Autophagy-related protein 8c [Zea mays] Length = 112 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 18 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 49 >ref|XP_008385876.1| PREDICTED: autophagy-related protein 8C-like [Malus domestica] ref|XP_008349900.1| PREDICTED: autophagy-related protein 8C [Malus domestica] Length = 117 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|EPS63017.1| autophagy 8a, partial [Genlisea aurea] Length = 117 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|EPS60837.1| autophagy 8a [Genlisea aurea] Length = 117 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >ref|XP_008226882.1| PREDICTED: autophagy-related protein 8C [Prunus mume] ref|XP_008364911.1| PREDICTED: autophagy-related protein 8C [Malus domestica] ref|XP_008364918.1| PREDICTED: autophagy-related protein 8C [Malus domestica] ref|XP_008364925.1| PREDICTED: autophagy-related protein 8C [Malus domestica] ref|XP_009361003.1| PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] ref|XP_009361004.1| PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] ref|XP_018503970.1| PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] ref|XP_020418244.1| autophagy-related protein 8C [Prunus persica] ref|XP_020418245.1| autophagy-related protein 8C [Prunus persica] ref|XP_020418246.1| autophagy-related protein 8C [Prunus persica] ref|XP_021829467.1| autophagy-related protein 8C [Prunus avium] ref|XP_021829468.1| autophagy-related protein 8C [Prunus avium] ref|XP_021829469.1| autophagy-related protein 8C [Prunus avium] gb|ONI13321.1| hypothetical protein PRUPE_4G215300 [Prunus persica] Length = 117 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >ref|XP_023520342.1| autophagy-related protein 8C-like [Cucurbita pepo subsp. pepo] Length = 118 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >ref|XP_022994202.1| autophagy-related protein 8C-like [Cucurbita maxima] ref|XP_022994203.1| autophagy-related protein 8C-like [Cucurbita maxima] ref|XP_022994204.1| autophagy-related protein 8C-like [Cucurbita maxima] ref|XP_022994205.1| autophagy-related protein 8C-like [Cucurbita maxima] ref|XP_022994206.1| autophagy-related protein 8C-like [Cucurbita maxima] Length = 118 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >ref|XP_022954812.1| autophagy-related protein 8C [Cucurbita moschata] ref|XP_022954813.1| autophagy-related protein 8C [Cucurbita moschata] ref|XP_022954814.1| autophagy-related protein 8C [Cucurbita moschata] ref|XP_022954815.1| autophagy-related protein 8C [Cucurbita moschata] ref|XP_022954816.1| autophagy-related protein 8C [Cucurbita moschata] ref|XP_023542800.1| autophagy-related protein 8C [Cucurbita pepo subsp. pepo] ref|XP_023542801.1| autophagy-related protein 8C [Cucurbita pepo subsp. pepo] ref|XP_023542802.1| autophagy-related protein 8C [Cucurbita pepo subsp. pepo] ref|XP_023542803.1| autophagy-related protein 8C [Cucurbita pepo subsp. pepo] ref|XP_023542805.1| autophagy-related protein 8C [Cucurbita pepo subsp. pepo] Length = 118 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56 >gb|PIA57828.1| hypothetical protein AQUCO_00500029v1 [Aquilegia coerulea] Length = 118 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 996 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 1091 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL Sbjct: 25 KYPDRIPVIVEKAERSDIPDIDKKKYLVPADL 56