BLASTX nr result
ID: Cheilocostus21_contig00007068
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00007068 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus g... 64 3e-09 gb|EEF45989.1| conserved hypothetical protein [Ricinus communis] 55 1e-06 >gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 63.5 bits (153), Expect = 3e-09 Identities = 42/77 (54%), Positives = 52/77 (67%), Gaps = 8/77 (10%) Frame = +2 Query: 194 LLHELVSQERVYV-----ASSSCLLLAKLNAL*HRHYG--RKTPFKADHDHLGAGAKPSR 352 +LHELVSQ R A+S+CLLLAKL L ++H ++ + ++GA AKPSR Sbjct: 37 VLHELVSQVRNEPCLQSRATSACLLLAKLLELDNKHSSIVKRLLIRPTTTYIGAIAKPSR 96 Query: 353 IKASSPY-SNSKRPTYS 400 IKASSPY SNSKRPTYS Sbjct: 97 IKASSPYSSNSKRPTYS 113 >gb|EEF45989.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 215 QERVYVASSSCLLLAKLNAL*HRHYGRKTPFKADHDH-LGAGAKPSRIKASSPYSNSKRP 391 ++R+Y S L ++ A+ + G +D DH +GA AKPSRIKAS+PYSNSKRP Sbjct: 3 EQRLYAFRSLSLKKNRMKAVVNSSLG------SDSDHYIGAIAKPSRIKASNPYSNSKRP 56 Query: 392 TYSP 403 TYSP Sbjct: 57 TYSP 60