BLASTX nr result
ID: Cheilocostus21_contig00007040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00007040 (908 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413787.1| PREDICTED: Bowman-Birk type proteinase inhib... 140 5e-38 ref|XP_020101746.1| Bowman-Birk type trypsin inhibitor-like [Ana... 115 1e-28 gb|OAY73109.1| Bowman-Birk type trypsin inhibitor [Ananas comosus] 115 2e-28 gb|OAY78149.1| Bowman-Birk type trypsin inhibitor [Ananas comosus] 115 3e-28 ref|XP_021312065.1| Bowman-Birk type trypsin inhibitor isoform X... 111 9e-27 ref|NP_001344695.1| uncharacterized LOC100502257 precursor [Zea ... 109 4e-26 ref|XP_004981231.1| Bowman-Birk type trypsin inhibitor [Setaria ... 108 1e-25 ref|XP_010943086.1| PREDICTED: Bowman-Birk type trypsin inhibito... 107 1e-25 ref|XP_010943076.1| PREDICTED: Bowman-Birk type trypsin inhibito... 107 1e-25 gb|PAN44250.1| hypothetical protein PAHAL_I01266 [Panicum hallii] 107 2e-25 dbj|BAJ91965.1| predicted protein, partial [Hordeum vulgare subs... 107 2e-25 ref|XP_010922262.1| PREDICTED: Bowman-Birk type trypsin inhibito... 107 3e-25 gb|ACR37912.1| unknown [Zea mays] 109 3e-25 dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] 107 5e-25 ref|XP_020148779.1| Bowman-Birk type proteinase inhibitor PVI-3(... 107 6e-25 ref|XP_010943044.1| PREDICTED: Bowman-Birk type trypsin inhibito... 105 1e-24 ref|XP_008784400.1| PREDICTED: Bowman-Birk type proteinase inhib... 106 1e-24 ref|XP_008665690.1| Bowman-Birk type trypsin inhibitor [Zea mays... 104 4e-24 ref|XP_015632395.1| PREDICTED: Bowman-Birk type trypsin inhibito... 103 1e-23 ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibito... 103 1e-23 >ref|XP_009413787.1| PREDICTED: Bowman-Birk type proteinase inhibitor DE-4-like [Musa acuminata subsp. malaccensis] gb|ABL63911.1| Bowman-Birk serine proteinase inhibitor [Musa acuminata AAA Group] gb|ARE30279.1| Bowman-Birk inhibitor 3 [Musa acuminata AAA Group] Length = 126 Score = 140 bits (353), Expect = 5e-38 Identities = 56/73 (76%), Positives = 62/73 (84%) Frame = +2 Query: 407 RGRRIRTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVP 586 R R+ RTWPCCDRCGGCTKS PP+C+CQD+VRSCHPSCR CVRSPL+V PPLY C D +P Sbjct: 52 RSRQRRTWPCCDRCGGCTKSTPPQCQCQDMVRSCHPSCRHCVRSPLSVSPPLYQCMDRIP 111 Query: 587 NYCHRRCKPEDLL 625 NYC RRC PE LL Sbjct: 112 NYCRRRCTPEPLL 124 >ref|XP_020101746.1| Bowman-Birk type trypsin inhibitor-like [Ananas comosus] Length = 116 Score = 115 bits (289), Expect = 1e-28 Identities = 43/71 (60%), Positives = 57/71 (80%), Gaps = 1/71 (1%) Frame = +2 Query: 398 EAARGR-RIRTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCT 574 + RG+ ++R WPCCDRCG CT+S PP+CRC D+VRSCHP+C+ CVRSPL+ DPPL+ C Sbjct: 36 QGERGKGKLRPWPCCDRCGPCTRSIPPQCRCLDMVRSCHPACKKCVRSPLSFDPPLFQCM 95 Query: 575 DLVPNYCHRRC 607 D++ NYC +C Sbjct: 96 DVITNYCKHKC 106 >gb|OAY73109.1| Bowman-Birk type trypsin inhibitor [Ananas comosus] Length = 134 Score = 115 bits (289), Expect = 2e-28 Identities = 44/71 (61%), Positives = 57/71 (80%), Gaps = 1/71 (1%) Frame = +2 Query: 398 EAARGR-RIRTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCT 574 E+ +G+ R R WPCCDRCG CT+S PP+CRC D+VRSCHP+C+ CVRSPL+ DPPL+ C Sbjct: 54 ESGKGQLRPRWWPCCDRCGACTRSIPPQCRCLDMVRSCHPACKKCVRSPLSFDPPLFQCM 113 Query: 575 DLVPNYCHRRC 607 D++ NYC +C Sbjct: 114 DVITNYCKHKC 124 >gb|OAY78149.1| Bowman-Birk type trypsin inhibitor [Ananas comosus] Length = 131 Score = 115 bits (288), Expect = 3e-28 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 1/68 (1%) Frame = +2 Query: 407 RGR-RIRTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLV 583 RG+ ++R WPCCDRCG CT+S PP+CRC D+VRSCHP+C+ CVRSPL+ DPPL+ C D++ Sbjct: 54 RGKGKLRPWPCCDRCGPCTRSIPPQCRCLDMVRSCHPACKKCVRSPLSFDPPLFQCMDVI 113 Query: 584 PNYCHRRC 607 NYC +C Sbjct: 114 TNYCKHKC 121 >ref|XP_021312065.1| Bowman-Birk type trypsin inhibitor isoform X2 [Sorghum bicolor] gb|KXG37239.1| hypothetical protein SORBI_3001G032100 [Sorghum bicolor] Length = 124 Score = 111 bits (277), Expect = 9e-27 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 2/73 (2%) Frame = +2 Query: 395 EEAARGRRI-RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYM 568 E A+RG+ R WPCCD CGGCTKS+P RC+C D V R CHP+CR CV+S L+ DPP+Y Sbjct: 45 ELASRGKAAARAWPCCDSCGGCTKSEPRRCQCLDAVPRGCHPACRDCVKSSLSADPPVYQ 104 Query: 569 CTDLVPNYCHRRC 607 C D VPN+C RRC Sbjct: 105 CMDRVPNFCQRRC 117 >ref|NP_001344695.1| uncharacterized LOC100502257 precursor [Zea mays] gb|AQK61871.1| Bowman-Birk type trypsin inhibitor [Zea mays] Length = 128 Score = 109 bits (273), Expect = 4e-26 Identities = 41/63 (65%), Positives = 49/63 (77%), Gaps = 1/63 (1%) Frame = +2 Query: 422 RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCH 598 R WPCCD CGGCT+S+PPRC+C D R CHP+CR CV+S L+ DPP+Y C D VPN+C Sbjct: 57 RAWPCCDSCGGCTRSEPPRCQCLDAAPRGCHPACRDCVKSSLSADPPVYQCMDRVPNFCQ 116 Query: 599 RRC 607 RRC Sbjct: 117 RRC 119 >ref|XP_004981231.1| Bowman-Birk type trypsin inhibitor [Setaria italica] gb|KQK86402.1| hypothetical protein SETIT_038883mg [Setaria italica] Length = 121 Score = 108 bits (269), Expect = 1e-25 Identities = 44/73 (60%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = +2 Query: 395 EEAARGRRI-RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYM 568 E A+RG+ R WPCCD CGGCTKS PP C+C D V R CHP+C+ C++S L+ DPP+Y Sbjct: 43 ELASRGKAAARAWPCCDNCGGCTKSIPPLCQCLDAVPRGCHPACQDCIKSSLSADPPVYQ 102 Query: 569 CTDLVPNYCHRRC 607 C D VPN+C RRC Sbjct: 103 CMDRVPNFCDRRC 115 >ref|XP_010943086.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like isoform X2 [Elaeis guineensis] Length = 111 Score = 107 bits (268), Expect = 1e-25 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +2 Query: 422 RTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCHR 601 R WPCC++CG CT+S+PP+C+C DLV++CHP C+ CV+SPL + PPLY C D + N+C + Sbjct: 42 RPWPCCNKCGVCTRSNPPQCQCLDLVKACHPKCKECVQSPLRIYPPLYQCKDWITNFCKK 101 Query: 602 RCKPEDL 622 +C P+ L Sbjct: 102 KCNPKPL 108 >ref|XP_010943076.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like isoform X1 [Elaeis guineensis] Length = 112 Score = 107 bits (268), Expect = 1e-25 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +2 Query: 422 RTWPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCHR 601 R WPCC++CG CT+S+PP+C+C DLV++CHP C+ CV+SPL + PPLY C D + N+C + Sbjct: 43 RPWPCCNKCGVCTRSNPPQCQCLDLVKACHPKCKECVQSPLRIYPPLYQCKDWITNFCKK 102 Query: 602 RCKPEDL 622 +C P+ L Sbjct: 103 KCNPKPL 109 >gb|PAN44250.1| hypothetical protein PAHAL_I01266 [Panicum hallii] Length = 119 Score = 107 bits (268), Expect = 2e-25 Identities = 45/73 (61%), Positives = 53/73 (72%), Gaps = 2/73 (2%) Frame = +2 Query: 395 EEAARGRRI-RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYM 568 E A+RG+ R WPCCD CGGCTKS+ P CRC D R CHP+CR CV+S L+ DPP+Y Sbjct: 41 ELASRGKAAARAWPCCDNCGGCTKSNRPLCRCLDAAPRGCHPACRDCVKSSLSADPPVYQ 100 Query: 569 CTDLVPNYCHRRC 607 C D VPN+C RRC Sbjct: 101 CMDRVPNFCARRC 113 >dbj|BAJ91965.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 99 Score = 107 bits (266), Expect = 2e-25 Identities = 44/70 (62%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 401 AARGRRIRTWPCCDRCGGCTKSDPPRCRCQDLVRS-CHPSCRSCVRSPLAVDPPLYMCTD 577 AA R WPCCD CGGCTKSD P+CRC D CHP+CR CV+S LAV PP+Y C D Sbjct: 24 AAAKARGSAWPCCDSCGGCTKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMD 83 Query: 578 LVPNYCHRRC 607 VPN+C RRC Sbjct: 84 RVPNFCQRRC 93 >ref|XP_010922262.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Elaeis guineensis] Length = 124 Score = 107 bits (267), Expect = 3e-25 Identities = 50/116 (43%), Positives = 67/116 (57%), Gaps = 4/116 (3%) Frame = +2 Query: 275 KRRTAAMKRSALLALGILTLVXXXXXXXXXXXXXXHLDLKEEAARGRR----IRTWPCCD 442 KRR + KRS ++L I+ ++ HL+ + G + WPCC+ Sbjct: 2 KRRRGSGKRSPSVSLAIIFMMAAYYFTTLSFAQP-HLNSQLPTNNGYEGESSRKPWPCCN 60 Query: 443 RCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCHRRCK 610 RCGGCT+S PP C+C DL R+CHP C+ CVRSPL+V+PPLY C D + YC CK Sbjct: 61 RCGGCTRSIPPECQCWDLTRACHPLCKECVRSPLSVEPPLYQCMDRIAGYCKIPCK 116 >gb|ACR37912.1| unknown [Zea mays] Length = 201 Score = 109 bits (273), Expect = 3e-25 Identities = 41/63 (65%), Positives = 49/63 (77%), Gaps = 1/63 (1%) Frame = +2 Query: 422 RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCH 598 R WPCCD CGGCT+S+PPRC+C D R CHP+CR CV+S L+ DPP+Y C D VPN+C Sbjct: 130 RAWPCCDSCGGCTRSEPPRCQCLDAAPRGCHPACRDCVKSSLSADPPVYQCMDRVPNFCQ 189 Query: 599 RRC 607 RRC Sbjct: 190 RRC 192 >dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 137 Score = 107 bits (266), Expect = 5e-25 Identities = 44/70 (62%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 401 AARGRRIRTWPCCDRCGGCTKSDPPRCRCQDLVRS-CHPSCRSCVRSPLAVDPPLYMCTD 577 AA R WPCCD CGGCTKSD P+CRC D CHP+CR CV+S LAV PP+Y C D Sbjct: 62 AAAKARGSAWPCCDSCGGCTKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMD 121 Query: 578 LVPNYCHRRC 607 VPN+C RRC Sbjct: 122 RVPNFCQRRC 131 >ref|XP_020148779.1| Bowman-Birk type proteinase inhibitor PVI-3(2)-like [Aegilops tauschii subsp. tauschii] Length = 141 Score = 107 bits (266), Expect = 6e-25 Identities = 44/70 (62%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 401 AARGRRIRTWPCCDRCGGCTKSDPPRCRCQDLVRS-CHPSCRSCVRSPLAVDPPLYMCTD 577 AA R WPCCD CGGCTKSD P+CRC D CHP+CR CV+SPLAV P +Y C D Sbjct: 65 AAAKARGSAWPCCDSCGGCTKSDTPQCRCMDAAPGGCHPACRDCVKSPLAVHPAVYQCMD 124 Query: 578 LVPNYCHRRC 607 VPN+C RRC Sbjct: 125 RVPNFCQRRC 134 >ref|XP_010943044.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Elaeis guineensis] Length = 112 Score = 105 bits (262), Expect = 1e-24 Identities = 36/65 (55%), Positives = 51/65 (78%) Frame = +2 Query: 428 WPCCDRCGGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCHRRC 607 WPCC++CG CT+S+PP+C+C DLV++CHP C+ CV+SPL + PPLY C D + N+C +C Sbjct: 45 WPCCNKCGVCTRSNPPQCQCLDLVKACHPKCKECVQSPLRIYPPLYQCKDWITNFCKHKC 104 Query: 608 KPEDL 622 P+ L Sbjct: 105 NPKPL 109 >ref|XP_008784400.1| PREDICTED: Bowman-Birk type proteinase inhibitor D-II-like [Phoenix dactylifera] Length = 139 Score = 106 bits (264), Expect = 1e-24 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 2/114 (1%) Frame = +2 Query: 275 KRRTAAMKRSALLALGILTLVXXXXXXXXXXXXXXHLDLK-EEAARGRRI-RTWPCCDRC 448 KRR + KRS ++L I+ ++ L G+ + WPCC+RC Sbjct: 19 KRRRGSGKRSPSVSLAIICMIAAYIATLSFAQPDLSSQLPTNNGYEGQNSGKPWPCCNRC 78 Query: 449 GGCTKSDPPRCRCQDLVRSCHPSCRSCVRSPLAVDPPLYMCTDLVPNYCHRRCK 610 GGCT+ PP C+C DL R+CHP C+ CVRSPL+V+PPLY C D + +YC CK Sbjct: 79 GGCTRFIPPECQCWDLTRACHPRCKECVRSPLSVEPPLYQCMDRIADYCKIPCK 132 >ref|XP_008665690.1| Bowman-Birk type trypsin inhibitor [Zea mays] gb|ONM10970.1| Bowman-Birk type trypsin inhibitor [Zea mays] Length = 127 Score = 104 bits (259), Expect = 4e-24 Identities = 43/73 (58%), Positives = 53/73 (72%), Gaps = 2/73 (2%) Frame = +2 Query: 395 EEAARGRRI-RTWPCCDRCGGCTKSDPPRCRCQDLV-RSCHPSCRSCVRSPLAVDPPLYM 568 E A+RG+ R WPCCD CGGCT+S+P CRC D R CHP+CR CV+S L+ DPP+Y Sbjct: 47 ELASRGKAAARAWPCCDSCGGCTRSEPRLCRCLDAAPRGCHPACRDCVKSSLSADPPVYQ 106 Query: 569 CTDLVPNYCHRRC 607 C D VP++C RRC Sbjct: 107 CMDRVPDFCLRRC 119 >ref|XP_015632395.1| PREDICTED: Bowman-Birk type trypsin inhibitor [Oryza sativa Japonica Group] gb|AAO18460.1| putative Bowman-Birk serine protease inhibitor [Oryza sativa Japonica Group] gb|ABF99616.1| Bowman-Birk serine protease inhibitor family protein, expressed [Oryza sativa Japonica Group] dbj|BAF13656.1| Os03g0823400 [Oryza sativa Japonica Group] gb|EEE60203.1| hypothetical protein OsJ_13170 [Oryza sativa Japonica Group] dbj|BAS87122.1| Os03g0823400 [Oryza sativa Japonica Group] Length = 127 Score = 103 bits (256), Expect = 1e-23 Identities = 44/86 (51%), Positives = 54/86 (62%), Gaps = 10/86 (11%) Frame = +2 Query: 380 HLDLKEEAARGRRIRT---------WPCCDRCGGCTKSDPPRCRCQDL-VRSCHPSCRSC 529 HL + E RG R+ WPCCD CGGCTKS PP+C+C D CHP+C+SC Sbjct: 37 HLHGRGEGERGGEARSLAAKGAAAAWPCCDNCGGCTKSIPPQCQCMDARPAGCHPACKSC 96 Query: 530 VRSPLAVDPPLYMCTDLVPNYCHRRC 607 V+S L+V PP+Y C D +PN C RRC Sbjct: 97 VKSSLSVSPPVYQCMDRIPNLCQRRC 122 >ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Brachypodium distachyon] gb|KQK12400.1| hypothetical protein BRADI_1g03510v3 [Brachypodium distachyon] Length = 135 Score = 103 bits (256), Expect = 1e-23 Identities = 39/67 (58%), Positives = 48/67 (71%), Gaps = 1/67 (1%) Frame = +2 Query: 416 RIRTWPCCDRCGGCTKSDPPRCRCQDLVRS-CHPSCRSCVRSPLAVDPPLYMCTDLVPNY 592 + + WPCCD CGGCTKS PPRC+C D CHP+C SCV+S L+V PP+Y C D + N+ Sbjct: 63 KAKAWPCCDSCGGCTKSIPPRCQCMDAAPGGCHPACESCVKSSLSVHPPVYHCMDRIANF 122 Query: 593 CHRRCKP 613 C RRC P Sbjct: 123 CQRRCSP 129