BLASTX nr result
ID: Cephaelis21_contig00054589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054589 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18084.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat... 67 2e-09 ref|XP_002309169.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_002526706.1| pentatricopeptide repeat-containing protein,... 58 7e-07 ref|XP_004137894.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-06 >emb|CBI18084.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 36 MTASPMVPAVLK--EIKTALFQGFNSLNQLKHVHGRLLRNGLSQNNYLINMVLQSSFKFS 209 M + P P + K EIK + QGFNS LKH+H LLR GL +NYL+NM+L+ SF FS Sbjct: 1 MLSRPTSPPISKGLEIKKLILQGFNSFKHLKHLHAHLLRFGLCHDNYLLNMILRCSFDFS 60 Query: 210 DPN 218 D N Sbjct: 61 DTN 63 >ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Vitis vinifera] Length = 686 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 36 MTASPMVPAVLK--EIKTALFQGFNSLNQLKHVHGRLLRNGLSQNNYLINMVLQSSFKFS 209 M + P P + K EIK + QGFNS LKH+H LLR GL +NYL+NM+L+ SF FS Sbjct: 1 MLSRPTSPPISKGLEIKKLILQGFNSFKHLKHLHAHLLRFGLCHDNYLLNMILRCSFDFS 60 Query: 210 DPN 218 D N Sbjct: 61 DTN 63 >ref|XP_002309169.1| predicted protein [Populus trichocarpa] gi|222855145|gb|EEE92692.1| predicted protein [Populus trichocarpa] Length = 619 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +3 Query: 75 IKTALFQGFNSLNQLKHVHGRLLRNGLSQNNYLINMVLQSSFKFSDPN 218 IK LFQGFNSL LKHVH LLR GL +++YL+N VL+ SF F + N Sbjct: 12 IKIRLFQGFNSLKHLKHVHAALLRLGLDEDSYLLNKVLRFSFNFGNTN 59 >ref|XP_002526706.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534006|gb|EEF35728.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 461 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = +3 Query: 39 TASPMVPAVLKEIKTALFQGFNSLNQLKHVHGRLLRNGLSQNNYLINMVLQSSFKFSD 212 T SP + L +K L Q FNSL QLKHVH LLR G Q +YL +M+++SSF F+D Sbjct: 7 TTSPSLINALN-LKNRLLQSFNSLKQLKHVHAALLRLGFDQGSYLWSMIIRSSFDFND 63 >ref|XP_004137894.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Cucumis sativus] Length = 688 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 2/65 (3%) Frame = +3 Query: 30 MSMTASPMVPAVLK--EIKTALFQGFNSLNQLKHVHGRLLRNGLSQNNYLINMVLQSSFK 203 M++ SP P K EIK L G N NQLKH+H RLLR L Q+NYL+N++L + Sbjct: 1 MTILTSPTSPVFSKALEIKNYLSNGLNFFNQLKHIHARLLRLHLDQDNYLLNLILCCALD 60 Query: 204 FSDPN 218 F N Sbjct: 61 FGSTN 65