BLASTX nr result
ID: Cephaelis21_contig00054563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054563 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279580.1| PREDICTED: probable leucine-rich repeat rece... 86 4e-15 ref|XP_003592627.1| Leucine-rich repeat receptor-like protein ki... 83 3e-14 ref|XP_004159291.1| PREDICTED: probable leucine-rich repeat rece... 82 4e-14 ref|XP_004135084.1| PREDICTED: probable leucine-rich repeat rece... 82 4e-14 ref|XP_002535240.1| receptor kinase, putative [Ricinus communis]... 79 5e-13 >ref|XP_002279580.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Vitis vinifera] Length = 671 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/47 (85%), Positives = 46/47 (97%) Frame = +3 Query: 3 IEEEMVGLLQIAMACSSASPDQRPKMNFVVKMIEELRGVEVSPAHET 143 IEEEMVGLLQIAMAC++ SPDQRPKM++VVKMIEE+RGVEVSP+HET Sbjct: 606 IEEEMVGLLQIAMACTTPSPDQRPKMSYVVKMIEEIRGVEVSPSHET 652 >ref|XP_003592627.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355481675|gb|AES62878.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Length = 669 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +3 Query: 3 IEEEMVGLLQIAMACSSASPDQRPKMNFVVKMIEELRGVEVSPAHET 143 IEEEMVGLLQIAM+C++ASPDQRP+M+ VVKMIEELRGVEVSP H+T Sbjct: 602 IEEEMVGLLQIAMSCTAASPDQRPRMSHVVKMIEELRGVEVSPCHDT 648 >ref|XP_004159291.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Cucumis sativus] Length = 672 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +3 Query: 3 IEEEMVGLLQIAMACSSASPDQRPKMNFVVKMIEELRGVEVSPAHE 140 IEEEMVGLLQIA+AC++ASPDQRPKMN VVKMI+ELRGVEVSP H+ Sbjct: 605 IEEEMVGLLQIALACTAASPDQRPKMNHVVKMIDELRGVEVSPFHD 650 >ref|XP_004135084.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Cucumis sativus] Length = 672 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +3 Query: 3 IEEEMVGLLQIAMACSSASPDQRPKMNFVVKMIEELRGVEVSPAHE 140 IEEEMVGLLQIA+AC++ASPDQRPKMN VVKMI+ELRGVEVSP H+ Sbjct: 605 IEEEMVGLLQIALACTAASPDQRPKMNHVVKMIDELRGVEVSPFHD 650 >ref|XP_002535240.1| receptor kinase, putative [Ricinus communis] gi|223523674|gb|EEF27142.1| receptor kinase, putative [Ricinus communis] Length = 260 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = +3 Query: 3 IEEEMVGLLQIAMACSSASPDQRPKMNFVVKMIEELRGVEVSPAHET 143 IEEEMVG+LQIAMAC+++ PDQRP+++ VVKMIEE+RGVEVSP HET Sbjct: 195 IEEEMVGVLQIAMACTASPPDQRPRISHVVKMIEEMRGVEVSPCHET 241