BLASTX nr result
ID: Cephaelis21_contig00054545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054545 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310252.1| predicted protein [Populus trichocarpa] gi|2... 40 8e-07 ref|XP_002521555.1| pentatricopeptide repeat-containing protein,... 45 2e-06 ref|XP_003594404.1| Pentatricopeptide repeat-containing protein ... 40 8e-06 >ref|XP_002310252.1| predicted protein [Populus trichocarpa] gi|222853155|gb|EEE90702.1| predicted protein [Populus trichocarpa] Length = 540 Score = 40.4 bits (93), Expect(2) = 8e-07 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -3 Query: 222 KDVISWMSMIDANGVHETRADVIALFKIIGD--SNVLPNSVT 103 K V+SW SMIDA G H + + LFK +G S VLPNS+T Sbjct: 353 KTVVSWTSMIDAYGRHGHGDEALKLFKEMGQEGSRVLPNSLT 394 Score = 37.4 bits (85), Expect(2) = 8e-07 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 103 ILVVLLACGI*GLVKQGLEYF*IFQEKYGMVPS 5 +L VL ACG GLVK+G E F +EKYG+ PS Sbjct: 395 LLAVLSACGHSGLVKEGQELFNSAREKYGLDPS 427 >ref|XP_002521555.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539233|gb|EEF40826.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 418 Score = 44.7 bits (104), Expect(2) = 2e-06 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 231 IF*KDVISWMSMIDANGVHETRADVIALFKIIG--DSNVLPNSVTF 100 IF KDV+SW SMIDA G H + + LFK +G + V PNS+TF Sbjct: 337 IFRKDVVSWTSMIDAYGRHGNGYEALELFKKMGLLGNMVSPNSITF 382 Score = 31.6 bits (70), Expect(2) = 2e-06 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -2 Query: 100 LVVLLACGI*GLVKQGLEYF*IFQEKYG 17 L VL ACG GLV++G E F + ++KYG Sbjct: 383 LAVLSACGHAGLVEEGRELFDLVRKKYG 410 >ref|XP_003594404.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355483452|gb|AES64655.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 516 Score = 40.4 bits (93), Expect(2) = 8e-06 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 231 IF*KDVISWMSMIDANGVHETRADVIALF-KIIGD-SNVLPNSVTF 100 IF KDVISW MID G + + + LF K++ D S VLPNSVTF Sbjct: 316 IFQKDVISWTCMIDGYGRNGCGYEAVELFWKMMEDGSEVLPNSVTF 361 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -2 Query: 100 LVVLLACGI*GLVKQGLEYF*IFQEKYGMVP 8 L VL ACG GLV++G + F I +EKYG+ P Sbjct: 362 LSVLSACGHSGLVEEGKQCFNIMKEKYGIDP 392